Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: canru-3lipa

Candida rugosa (Diutina rugosa) (Yeast) triacylglycerol lipase 3 precursor

Relationship
Family|Fungal_carboxylesterase_lipase
Block| C
Position in NCBI Life Tree|Candida rugosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Saccharomycotina: N E > Saccharomycetes: N E > Saccharomycetales: N E > Saccharomycetales incertae sedis: N E > Diutina: N E > Diutina rugosa: N E


Molecular evidence
Database
No mutation
2 structures: 1CLE, 1LLF
No kinetic





2 substrates: Cholesteryl-linoleate, Glucose-pentaacetate
No inhibitor
3 Genbank : X66006, X66006, CAA46805
1 UniProt : P32947
1 Ncbi-nid : 296933
2 Structure : 1CLE, 1LLF
1 UniProt : P32947
1 Interpro : P32947
1 Prodom : P32947
1 Pfam : P32947
1 PIRSF : P32947
1 SUPERFAM : P32947
Sequence
Graphical view for this peptide sequence: canru-3lipa
Colored MSA for Fungal_carboxylesterase_lipase (raw)
MKLALALSLIASVAAAPTAKLANGDTITGLNAIINEAFLGIPFAEPPVGN
LRFKDPVPYSGSLNGQKFTSYGPSCMQQNPEGTFEENLGKTALDLVMQSK
VFQAVLPQSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEIGSPTIFPP
AQMVTKSVLMGKPIIHVAVNYRVASWGFLAGDDIKAEGSGNAGLKDQRLG
MQWVADNIAGFGGDPSKVTIFGESAGSMSVLCHLIWNDGDNTYKGKPLFR
AGIMQSGAMVPSDPVDGTYGNEIYDLFVSSAGCGSASDKLACLRSASSDT
LLDATNNTPGFLAYSSLRLSYLPRPDGKNITDDMYKLVRDGKYASVPVII
GDQNDEGTIFGLSSLNVTTNAQARAYFKQSFIHASDAEIDTLMAAYPQDI
TQGSPFDTGIFNAITPQFKRISAVLGDLAFIHARRYFLNHFQGGTKYSFL
SKQLSGLPIMGTFHANDIVWQDYLLGSGSVIYNNAFIAFATDLDPNTAGL
LVNWPKYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALMTNPSSFFV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKLALALSLIASVAAAPTAKLANGDTITGLNAIINEAFLGIPFAEPPVGN
LRFKDPVPYSGSLNGQKFTSYGPSCMQQNPEGTFEENLGKTALDLVMQSK
VFQAVLPQSEDCLTINVVRPPGTKAGANLPVMLWIFGGGFEIGSPTIFPP
AQMVTKSVLMGKPIIHVAVNYRVASWGFLAGDDIKAEGSGNAGLKDQRLG
MQWVADNIAGFGGDPSKVTIFGESAGSMSVLCHLIWNDGDNTYKGKPLFR
AGIMQSGAMVPSDPVDGTYGNEIYDLFVSSAGCGSASDKLACLRSASSDT
LLDATNNTPGFLAYSSLRLSYLPRPDGKNITDDMYKLVRDGKYASVPVII
GDQNDEGTIFGLSSLNVTTNAQARAYFKQSFIHASDAEIDTLMAAYPQDI
TQGSPFDTGIFNAITPQFKRISAVLGDLAFIHARRYFLNHFQGGTKYSFL
SKQLSGLPIMGTFHANDIVWQDYLLGSGSVIYNNAFIAFATDLDPNTAGL
LVNWPKYTSSSQSGNNLMMINALGLYTGKDNFRTAGYDALMTNPSSFFV


References
4 more
    Title: Contribution of the Oligomeric State to the Thermostability of Isoenzyme 3 from Candida rugosa
    Alvarez-Cao ME, Gonzalez R, Pernas MA, Rua ML
    Ref: Microorganisms, 6:, 2018 : PubMed

            

    Title: Three-dimensional structure of homodimeric cholesterol esterase-ligand complex at 1.4 A resolution
    Pletnev V, Addlagatta A, Wawrzak Z, Duax W
    Ref: Acta Crystallographica D Biol Crystallogr, 59:50, 2003 : PubMed

            

    Title: Influence of the conformational flexibility on the kinetics and dimerisation process of two Candida rugosa lipase isoenzymes
    Pernas MA, Lopez C, Rua ML, Hermoso J
    Ref: FEBS Letters, 501:87, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer