Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cavpo-lcat

Cavia porcellus (Guinea pig) lecithin: cholesterol acyl-transferase (fragment)

Comment
This entry also contains links to numerous short sequences of rodents sequenced for evolution studies: Microtus nivalis (Snow vole), Myocastor coypus (Coypu) (Nutria), Myoxus glis (Fat dormouse) (Glis glis), Octodon lunatus (moon-toothed degu), Peromyscus maniculatus (North American deer mouse), Peromyscus truei (Pinyon mouse), Peromyscus gratus (Osgood's mouse), Sciurus griseus (western gray squirrel), Spalax leucodon ehrenbergi (Ehrenberg's mole rat), Uranomys ruddi (White-bellied brush-furred rat) (Rudd's mouse), Steatomys sp., Sicista kazbegica (Kazbeg birch mouse), Phodopus roborowski, Otomys angoniensis (Angoni vlei rat), Nesomys rufus (island mouse), Napaeozapus insignis (woodland jumping mouse), Neotoma fuscipes (dusky-footed woodrat), Myospalax sp., Macrotarsomys ingens (greater big-footed mouse), Mesocricetus auratus (Golden hamster), Mystromys albicaudatus (white-tailed mouse), Lophuromys sikapusi (rusty-bellied brush-furred rat), Jaculus jaculus (Lesser Egyptian jerboa), Dicrostonyx torquatus (Arctic lemming), Dipus sagitta (northern three-toed jerboa), Dendromus mystacalis (chestnut climbing mouse), Deomys ferrugineus (Congo forest mouse), Calomyscus mystax (Afghan mouse-like hamster), Allactaga elater (small five-toed jerboa), Erinaceus europaeus (Western European hedgehog), Acomys cahirinus (Egyptian spiny mouse), Aplodontia rufa (Mountain beaver), Graphiurus microtis (small-eared dormouse), Graphiurus murinus (African dormouse), Graphiurus lorraineus (Lorrain dormouse), Graphiurus parvus (savanna dormouse), Graphiurus platyops (rock dormouse), Graphiurus ocularis (spectacled dormouse), Eliomys melanurus (Asian garden dormouse), Dryomys laniger (woolly dormouse), Myomimus roachi (Roach's mouse-tailed dormouse), Lasiopodomys brandtii (Brandt's vole), Lasiopodomys mandarinus (Mandarin vole), Microtus oeconomus (Tundra vole), Eolagurus luteus (Yellow steppe lemming), Microtus daghestanicus (Daghestan pine vole), Lemmus sibiricus (brown lemming), Chionomys gud (Gudaur snow vole), Arvicola amphibius (Eurasian water mole) (Arvicola terrestris), Myodes rufocanus (Gray red-backed vole) (Clethrionomys rufocanus), Dicrostonyx torquatus (Arctic lemming), Microtus middendorffi (Middendorf's vole), Myodes glareolus (Bank vole) (Clethrionomys glareolus), Microtus gregalis (Narrow-headed vole), Ellobius talpinus (Northern mole vole), Chionomys nivalis (European snow vole) (Microtus nivalis), Lagurus lagurus, Microtus arvalis (Common vole) (Field vole),Myopus schisticolor (Wood lemming)


Relationship
Family|PC-sterol_acyltransferase
Block| L
Position in NCBI Life Tree|Cavia porcellus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Hystricomorpha: N E > Caviidae: N E > Cavia: N E > Cavia porcellus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 127 more: AF183896, AF183901, U72301
>3 UniProt links 53 more: H0W594, O08945, O08944
>3 UniProt links 80 more: H0W594, Q9ESE7, Q9ESE6
>3 Interpro links 80 more: H0W594, Q9ESE7, Q9ESE6
>3 Pfam links 80 more: H0W594, Q9ESE7, Q9ESE6
>3 PIRSF links 80 more: H0W594, Q9ESE7, Q9ESE6
>3 SUPERFAM links 80 more: H0W594, Q9ESE7, Q9ESE6
Sequence
Graphical view for this peptide sequence: cavpo-lcat
Colored MSA for PC-sterol_acyltransferase (raw)
MGPPGSPWQWFWLLNVLFPPHTTPKAELSNHTRPVILVPGCLGNQLEAKL
DKPDVVNWMCYRKTEDFFTIWLDLNMFLPFGVDCWIDNTRVVYNRSSGRV
SNAPGVEIRVPGFGKTYSVEYLDSNKLAGYMHTLVQNLVNNGYVRDETVR
AAPYDWRLEPGQQEEYYQKLARLVEEMHAAYGKPVFLIGHSLGCLHLLYF
LLRQPQSWKDHFIDGFISLGAPWGGSTKPMLVLATGNNQGIPLMSSIKLR
EEQRITTTSPWMFPSYRVWPEGHVFISTPSFNYTGRDFQRFFGDLHFEDG
WYMWLQSRDLLAGLPAPGVEVYCLYGVGLSTPSTYIYDHGFPYSDPVNVL
YEDGDDTVATRSTELCGLWQGRQPQPVHLLPLNGTQHLNMVFSNQTLEHI
NTILLGAYRHNTPAYPTASPGLLPPE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGPPGSPWQWFWLLNVLFPPHTTPKAELSNHTRPVILVPGCLGNQLEAKL
DKPDVVNWMCYRKTEDFFTIWLDLNMFLPFGVDCWIDNTRVVYNRSSGRV
SNAPGVEIRVPGFGKTYSVEYLDSNKLAGYMHTLVQNLVNNGYVRDETVR
AAPYDWRLEPGQQEEYYQKLARLVEEMHAAYGKPVFLIGHSLGCLHLLYF
LLRQPQSWKDHFIDGFISLGAPWGGSTKPMLVLATGNNQGIPLMSSIKLR
EEQRITTTSPWMFPSYRVWPEGHVFISTPSFNYTGRDFQRFFGDLHFEDG
WYMWLQSRDLLAGLPAPGVEVYCLYGVGLSTPSTYIYDHGFPYSDPVNVL
YEDGDDTVATRSTELCGLWQGRQPQPVHLLPLNGTQHLNMVFSNQTLEHI
NTILLGAYRHNTPAYPTASPGLLPPE


References
1 more
    Title: Reproductive protein evolution within and between species: maintenance of divergent ZP3 alleles in Peromyscus
    Turner LM, Hoekstra HE
    Ref: Mol Ecol, 17:2616, 2008 : PubMed

            

    Title: The Bushlike Radiation of Muroid Rodents Is Exemplified by the Molecular Phylogeny of the LCAT Nuclear Gene
    Michaux J, Catzeflis F
    Ref: Mol Phylogenet Evol, 17:280, 2000 : PubMed

            

    Title: Nuclear gene LCAT supports rodent monophyly.
    Robinson-Rechavi M, Ponger L, Mouchiroud D
    Ref: Mol Biol Evol, 17:1410, 2000 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer