(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Eukaryota: NE > Opisthokonta: NE > Metazoa: NE > Eumetazoa: NE > Bilateria: NE > Deuterostomia: NE > Chordata: NE > Craniata: NE > Vertebrata: NE > Gnathostomata: NE > Teleostomi: NE > Euteleostomi: NE > Sarcopterygii: NE > Dipnotetrapodomorpha: NE > Tetrapoda: NE > Amniota: NE > Mammalia: NE > Theria: NE > Eutheria: NE > Boreoeutheria: NE > Euarchontoglires: NE > Glires: NE > Rodentia: NE > Hystricomorpha: NE > Caviidae: NE > Cavia: NE > Cavia porcellus: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Myocastor coypus: N, E.
Glis glis: N, E.
Myoxus glis: N, E.
Octodon lunatus: N, E.
Peromyscus gratus: N, E.
Peromyscus truei: N, E.
Sciurus griseus: N, E.
Nannospalax ehrenbergi: N, E.
Uranomys ruddi: N, E.
Steatomys sp.: N, E.
Sicista kazbegica: N, E.
Phodopus roborovskii: N, E.
Phodopus roborowski: N, E.
Nesomys rufus: N, E.
Napaeozapus insignis: N, E.
Neotoma fuscipes: N, E.
Myospalax sp.: N, E.
Macrotarsomys ingens: N, E.
Mesocricetus auratus: N, E.
Mystromys albicaudatus: N, E.
Lophuromys sikapusi: N, E.
Jaculus jaculus: N, E.
Dicrostonyx torquatus: N, E.
Dipus sagitta: N, E.
Dendromus mystacalis: N, E.
Deomys ferrugineus: N, E.
Calomyscus mystax: N, E.
Allactaga elater: N, E.
Erinaceus europaeus: N, E.
Acomys cahirinus: N, E.
Aplodontia rufa: N, E.
Graphiurus microtis: N, E.
Graphiurus murinus: N, E.
Graphiurus lorraineus: N, E.
Graphiurus parvus: N, E.
Graphiurus platyops: N, E.
Graphiurus ocularis: N, E.
Eliomys melanurus: N, E.
Dryomys laniger: N, E.
Myomimus roachi: N, E.
Lasiopodomys brandtii: N, E.
Lasiopodomys mandarinus: N, E.
Microtus oeconomus: N, E.
Eolagurus luteus: N, E.
Microtus daghestanicus: N, E.
Lemmus sibiricus: N, E.
Chionomys gud: N, E.
Arvicola amphibius: N, E.
Myodes rufocanus: N, E.
Microtus middendorffii: N, E.
Clethrionomys glareolus: N, E.
Myodes glareolus: N, E.
Ellobius talpinus: N, E.
Microtus nivalis: N, E.
Chionomys nivalis: N, E.
Lagurus lagurus: N, E.
Microtus arvalis: N, E.
Myopus schisticolor: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MGPPGSPWQWFWLLNVLFPPHTTPKAELSNHTRPVILVPGCLGNQLEAKL DKPDVVNWMCYRKTEDFFTIWLDLNMFLPFGVDCWIDNTRVVYNRSSGRV SNAPGVEIRVPGFGKTYSVEYLDSNKLAGYMHTLVQNLVNNGYVRDETVR AAPYDWRLEPGQQEEYYQKLARLVEEMHAAYGKPVFLIGHSLGCLHLLYF LLRQPQSWKDHFIDGFISLGAPWGGSTKPMLVLATGNNQGIPLMSSIKLR EEQRITTTSPWMFPSYRVWPEGHVFISTPSFNYTGRDFQRFFGDLHFEDG WYMWLQSRDLLAGLPAPGVEVYCLYGVGLSTPSTYIYDHGFPYSDPVNVL YEDGDDTVATRSTELCGLWQGRQPQPVHLLPLNGTQHLNMVFSNQTLEHI NTILLGAYRHNTPAYPTASPGLLPPE
References
1 moreTitle: Reproductive protein evolution within and between species: maintenance of divergent ZP3 alleles in Peromyscus Turner LM, Hoekstra HE Ref: Mol Ecol, 17:2616, 2008 : PubMed
In a variety of animal taxa, proteins involved in reproduction evolve more rapidly than nonreproductive proteins. Most studies of reproductive protein evolution, however, focus on divergence between species, and little is known about differentiation among populations within a species. Here we investigate the molecular population genetics of the protein ZP3 within two Peromyscus species. ZP3 is an egg coat protein involved in primary binding of egg and sperm and is essential for fertilization. We find that amino acid polymorphism in the sperm-combining region of ZP3 is high relative to silent polymorphism in both species of Peromyscus. In addition, while there is geographical structure at a mitochondrial gene (Cytb), a nuclear gene (Lcat) and eight microsatellite loci, we find no evidence for geographical structure at Zp3 in Peromyscus truei. These patterns are consistent with the maintenance of ZP3 alleles by balancing selection, possibly due to sexual conflict or pathogen resistance. However, we do not find evidence that reinforcement promotes ZP3 diversification; allelic variation in P. truei is similar among populations, including populations allopatric and sympatric with sibling species. In fact, most alleles are present in all populations sampled across P. truei's range. While additional data are needed to identify the precise evolutionary forces responsible for sequence variation in ZP3, our results suggest that in Peromyscus, selection to maintain divergent alleles within species contributes to the pattern of rapid amino acid substitution observed among species.
Title: The Bushlike Radiation of Muroid Rodents Is Exemplified by the Molecular Phylogeny of the LCAT Nuclear Gene Michaux J, Catzeflis F Ref: Mol Phylogenet Evol, 17:280, 2000 : PubMed
Phylogenetic relationships among 40 extant species of rodents, with an emphasis on the taxonomic sampling of Muridae and Dipodidae, were studied using sequences of the nuclear protein-coding gene LCAT (lecithin cholesterol acyl transferase). Analysis of 804 bp from the exonic regions of LCAT confirmed many traditional groupings in and around Muridae. A strong support was found for the families Muridae (represented by 29 species) and Dipodidae (5 species). Compared with Sciuridae, Gliridae, and Caviomorpha, the Dipodidae family appeared the closest relative of Muridae, confirming the suprafamilial Myodonta concept. Within the speciose family Muridae, the first branching leads to the fossorial Spalacinae and semifossorial Rhyzomyinae. The remaining components of Muridae appear as a polytomy from which are issued Sigmodontinae, Calomyscinae, Arvicolinae, Cricetinae, Mystromyinae, Nesomyinae, and some Dendromurinae (Steatomys and Dendromus). This phylogeny is interpreted as the result of a bushlike radiation at the end of the early Miocene, leading to emergence of most living subfamilies. The separation between three additional taxa, Murinae, Gerbillinae, and "Acomyinae" (which comprises the genera Acomys, Deomys, Uranomys, and Lophuromys), has occurred more recently from a common ancestor issued from the main basal radiation. As previously shown by other molecular studies, the vlei rats, Otomyinae, are nested within Old World Murinae. In the same way, the zokors, Myospalacinae, appear strongly nested within the hamsters, Cricetinae. Finally, we propose a sister group relationship between Malagasy Nesomyinae and south African Mystromyinae.
Phylogenetic analysis of the supraspecies relationships was carried out using partial sequences of two nuclear genes in the subfamily Arvicolinae, which is one of the youngest and species-rich groups of myomorph rodents. The analysis with the new data resolved the majority of polytomy nodes in the phylogenetic trees reported for Arvicolinae, suggesting a gradual, rather than a saltatory, mode for their evolution. Mole voles Ellobiusini, steppe voles Lagurini, and gray voles Arvicolini were fount to be a monophyletic group that corresponds to the latest third wave of radiation within the subfamily. Red-back voles Myodini (=Clethrionomini) are a sister clade to this group and correspond to the second radiation wave. The order of divergence remained unresolved for the earliest radiation wave (Ondatrini, Prometheomyini, Dicrostonychini, and Lemmini). The close relationships observed for mole, gray, and steppe voles are unexpected and contradict the conventional views that Ellobiusini are an ancient group and are separate from all other voles on evidence of the extreme simplicity of their rooted molars and the peculiar structure of their skull and postcranial skeleton. It was assumed that many of these morphological characters indicate adaptation to subterranean life and provide no phylogenetic signal.
Title: Reproductive protein evolution within and between species: maintenance of divergent ZP3 alleles in Peromyscus Turner LM, Hoekstra HE Ref: Mol Ecol, 17:2616, 2008 : PubMed
In a variety of animal taxa, proteins involved in reproduction evolve more rapidly than nonreproductive proteins. Most studies of reproductive protein evolution, however, focus on divergence between species, and little is known about differentiation among populations within a species. Here we investigate the molecular population genetics of the protein ZP3 within two Peromyscus species. ZP3 is an egg coat protein involved in primary binding of egg and sperm and is essential for fertilization. We find that amino acid polymorphism in the sperm-combining region of ZP3 is high relative to silent polymorphism in both species of Peromyscus. In addition, while there is geographical structure at a mitochondrial gene (Cytb), a nuclear gene (Lcat) and eight microsatellite loci, we find no evidence for geographical structure at Zp3 in Peromyscus truei. These patterns are consistent with the maintenance of ZP3 alleles by balancing selection, possibly due to sexual conflict or pathogen resistance. However, we do not find evidence that reinforcement promotes ZP3 diversification; allelic variation in P. truei is similar among populations, including populations allopatric and sympatric with sibling species. In fact, most alleles are present in all populations sampled across P. truei's range. While additional data are needed to identify the precise evolutionary forces responsible for sequence variation in ZP3, our results suggest that in Peromyscus, selection to maintain divergent alleles within species contributes to the pattern of rapid amino acid substitution observed among species.
Title: The Bushlike Radiation of Muroid Rodents Is Exemplified by the Molecular Phylogeny of the LCAT Nuclear Gene Michaux J, Catzeflis F Ref: Mol Phylogenet Evol, 17:280, 2000 : PubMed
Phylogenetic relationships among 40 extant species of rodents, with an emphasis on the taxonomic sampling of Muridae and Dipodidae, were studied using sequences of the nuclear protein-coding gene LCAT (lecithin cholesterol acyl transferase). Analysis of 804 bp from the exonic regions of LCAT confirmed many traditional groupings in and around Muridae. A strong support was found for the families Muridae (represented by 29 species) and Dipodidae (5 species). Compared with Sciuridae, Gliridae, and Caviomorpha, the Dipodidae family appeared the closest relative of Muridae, confirming the suprafamilial Myodonta concept. Within the speciose family Muridae, the first branching leads to the fossorial Spalacinae and semifossorial Rhyzomyinae. The remaining components of Muridae appear as a polytomy from which are issued Sigmodontinae, Calomyscinae, Arvicolinae, Cricetinae, Mystromyinae, Nesomyinae, and some Dendromurinae (Steatomys and Dendromus). This phylogeny is interpreted as the result of a bushlike radiation at the end of the early Miocene, leading to emergence of most living subfamilies. The separation between three additional taxa, Murinae, Gerbillinae, and "Acomyinae" (which comprises the genera Acomys, Deomys, Uranomys, and Lophuromys), has occurred more recently from a common ancestor issued from the main basal radiation. As previously shown by other molecular studies, the vlei rats, Otomyinae, are nested within Old World Murinae. In the same way, the zokors, Myospalacinae, appear strongly nested within the hamsters, Cricetinae. Finally, we propose a sister group relationship between Malagasy Nesomyinae and south African Mystromyinae.
Cavia porcellus (Guinea pig) phospolipase [PLRP2 like]