Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: colgl-cutas

Colletotrichum gloeosporioides (Anthracnose fungus)(Glomerell cingulata), Colletotrichum truncatum cutinase

Comment
Other strains: Colletotrichum gloeosporioides (Anthracnose fungus)(Glomerell cingulata); Colletotrichum truncatum few differences in N-term of Trembl P11373 and Trembl Q8X1A3 cingulata)


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Colletotrichum gloeosporioides
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > sordariomyceta: N E > Sordariomycetes: N E > Hypocreomycetidae: N E > Glomerellales: N E > Glomerellaceae: N E > Colletotrichum: N E > Colletotrichum gloeosporioides: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
3 structures: 3DCN, 3DD5, 3DEA
No kinetic





1 substrate:
Cutin
2 inhibitors: PETFP, Paraoxon
3 Genbank : M21443, AF444194, HQ406775
2 UniProt : P11373, E5LCF0
1 Ncbi-nid : 167289
1 Ncbi-pid : 167290
3 Structure : 3DEA, 3DCN, 3DD5
2 UniProt : P11373, E5LCF0
2 Interpro : P11373, E5LCF0
2 Prodom : P11373, E5LCF0
2 Pfam : P11373, E5LCF0
2 PIRSF : P11373, E5LCF0
2 SUPERFAM : P11373, E5LCF0
Sequence
Graphical view for this peptide sequence: colgl-cutas
Colored MSA for Cutinase (raw)
MKFLSVLSLAITLAAAAPVEVETGVALETRQSSTRNELETGSSSACPKVI
YIFARASTEPGNMGISAGPIVADALERIYGANNVWVQGVGGPYLADLASN
FLPDGTSSAAINEARRLFTLANTKCPNAAIVSGGYSQGTAVMAGSISGLS
TTIKNQIKGVVLFGYTKNLQNLGRIPNFETSKTEVYCDIADAVCYGTLFI
LPAHFLYQTDAAVAAPRFLQARIG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFLSVLSLAITLAAAAPVEVETGVALETRQSSTRNELETGSSSACPKVI
YIFARASTEPGNMGISAGPIVADALERIYGANNVWVQGVGGPYLADLASN
FLPDGTSSAAINEARRLFTLANTKCPNAAIVSGGYSQGTAVMAGSISGLS
TTIKNQIKGVVLFGYTKNLQNLGRIPNFETSKTEVYCDIADAVCYGTLFI
LPAHFLYQTDAAVAAPRFLQARIG


References
1 more
    Title: Crystallization and preliminary X-ray analysis of recombinant Glomerella cingulata cutinase
    Nyon MP, Rice DW, Berrisford JM, Huang H, Moir AJ, Craven CJ, Nathan S, Mahadi NM, Abu Bakar FD
    Ref: Acta Crystallographica Sect F Struct Biol Cryst Commun, 64:504, 2008 : PubMed

            

    Title: Purification and identification of cutinases from Colletotrichum kahawae and Colletotrichum gloeosporioides
    Chen Z, Franco CF, Baptista RP, Cabral JM, Coelho AV, Rodrigues CJ, Jr., Melo EP
    Ref: Applied Microbiology & Biotechnology, 73:1306, 2007 : PubMed

            

    Title: Structure of cutinase gene, cDNA, and the derived amino acid sequence from phytopathogenic fungi
    Ettinger WF, Thukral SK, Kolattukudy PE
    Ref: Biochemistry, 26:7883, 1987 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer