Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cultr-ACHE1

Culex tritaeniorhynchus Ace2 mRNA for acetylcholinesterase

Comment
Ace2 is close to the other insect Ace1 and is named accordingly cultr-ACHE1. Q75VX9 Strain Kochi


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Culex tritaeniorhynchus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Diptera: N E > Nematocera: N E > Culicomorpha: N E > Culicoidea: N E > Culicidae: N E > Culicinae: N E > Culicini: N E > Culex [genus]: N E > Culex [subgenus]: N E > Culex tritaeniorhynchus: N E


Molecular evidence
Database
1 mutation: cultr-ACHE1
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AB122152, AY147798, JX280897
2 UniProt : Q2TVM4, J7GM76
1 Ncbi-nid : 40363515
1 Ncbi-pid : 40363516
3 UniProt : Q75VX9, Q2TVM4, J7GM76
3 Interpro : Q75VX9, Q2TVM4, J7GM76
3 Prodom : Q75VX9, Q2TVM4, J7GM76
3 Pfam : Q75VX9, Q2TVM4, J7GM76
3 PIRSF : Q75VX9, Q2TVM4, J7GM76
3 SUPERFAM : Q75VX9, Q2TVM4, J7GM76
Sequence
Graphical view for this peptide sequence: cultr-ACHE1
Colored MSA for ACHE (raw)
MRPLQAMEIRGLITRLLGPCHLRHLILCSLGLYSILVQSVHCRHHDIGSS
AAHQLGSKYSQSSSLSSSSQSSSSLAEEATLNKDSGHGDSVRIVDAELGT
LEREHIHSTTTRRRGLTRRESNSDSTDSDPLVITTDKGKIRGTTLEAPSG
KKVDAWMGIPYAQPPLGPLRFRHPRPAERWSGVLNATKPPNSCVQIVDTV
FGDFPGATMWNPNTPLSEDCLYINVVAPRPRPKNAAVMLWIFGGGFYSGT
ATLDVYDHRTLASEENVIVVSLQYRVASLGFLFLGTPEAPGNAGLFDQNL
ALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAILQ
SGSPTAPWALVSREEATLRALRLAEAVNCPHDATKLSEAVECLRTKDPNE
LVDNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKTEILTGSNTE
EGYYFIIYYLTELLRKEEGVTVSREEFLQAVRELNPYVNGAARQAIVFEY
TDWIEPDNPNSNRDALDKMVGDYHFTCNVNEFAQRYAEEGNNVFMYLYTH
RSKGNPWPRWTGVMHGDEINYVFGEPLNAALGYQEDEKDFSRKIMRYWSN
FAKTGNPNPSPPNADLPEWPKHTAHGRHYLELGLNTSFVGRGPRLRQCAF
WKKYLPQLVAATSNLQVTPAPSVPCESSSTSYRSSTLLLIVTLLLVIRFK
I
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRPLQAMEIRGLITRLLGPCHLRHLILCSLGLYSILVQSVHCRHHDIGSS
AAHQLGSKYSQSSSLSSSSQSSSSLAEEATLNKDSGHGDSVRIVDAELGT
LEREHIHSTTTRRRGLTRRESNSDSTDSDPLVITTDKGKIRGTTLEAPSG
KKVDAWMGIPYAQPPLGPLRFRHPRPAERWSGVLNATKPPNSCVQIVDTV
FGDFPGATMWNPNTPLSEDCLYINVVAPRPRPKNAAVMLWIFGGGFYSGT
ATLDVYDHRTLASEENVIVVSLQYRVASLGFLFLGTPEAPGNAGLFDQNL
ALRWVRDNIHRFGGDPSRVTLFGESAGAVSVSLHLLSALSRDLFQRAILQ
SGSPTAPWALVSREEATLRALRLAEAVNCPHDATKLSEAVECLRTKDPNE
LVDNEWGTLGICEFPFVPVVDGAFLDETPQRSLASGRFKKTEILTGSNTE
EGYYFIIYYLTELLRKEEGVTVSREEFLQAVRELNPYVNGAARQAIVFEY
TDWIEPDNPNSNRDALDKMVGDYHFTCNVNEFAQRYAEEGNNVFMYLYTH
RSKGNPWPRWTGVMHGDEINYVFGEPLNAALGYQEDEKDFSRKIMRYWSN
FAKTGNPNPSPPNADLPEWPKHTAHGRHYLELGLNTSFVGRGPRLRQCAF
WKKYLPQLVAATSNLQVTPAPSVPCESSSTSYRSSTLLLIVTLLLVIRFK
I


Reference
    Title: An amino acid substitution attributable to insecticide-insensitivity of acetylcholinesterase in a Japanese encephalitis vector mosquito, Culex tritaeniorhynchus
    Nabeshima T, Mori A, Kozaki T, Iwata Y, Hidoh O, Harada S, Kasai S, Severson DW, Kono Y, Tomita T
    Ref: Biochemical & Biophysical Research Communications, 313:794, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer