Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: cydpo-ACHE2

Cydia pomonella strain S Cydia molesta (Oriental fruit moth) (Grapholita molesta) acetylcholinesterase 2 (Ace2) mRNA

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Cydia pomonella
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Amphiesmenoptera: N E > Lepidoptera: N E > Glossata: N E > Neolepidoptera: N E > Heteroneura: N E > Ditrysia: N E > Apoditrysia: N E > Tortricoidea: N E > Tortricidae: N E > Olethreutinae: N E > Grapholitini: N E > Cydia: N E > Cydia pomonella: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : DQ267976, HM775184
2 UniProt : Q2XQ04, F8RNK3
1 Ncbi-nid : 82468547
1 Ncbi-pid : 82468548
2 UniProt : Q2XQ04, F8RNK3
2 Interpro : Q2XQ04, F8RNK3
2 Prodom : Q2XQ04, F8RNK3
2 Pfam : Q2XQ04, F8RNK3
2 PIRSF : Q2XQ04, F8RNK3
2 SUPERFAM : Q2XQ04, F8RNK3
Sequence
Graphical view for this peptide sequence: cydpo-ACHE2
Colored MSA for ACHE (raw)
MTCNTKIVITKLLVCFLLSGVRGRSWASHHDTTTSTTQTTPTTSPAPKNF
HNDPLVVETKSGLVKGYAKTVMGREVHIFTGIPFAKPPLGPLRFRKPVPI
EPWHGVLDATAMPNSCYQERYEYFPGFEGEEMWNPNTNISEDCLYLNIWV
PQHLRVRHHQDKPLAERPKVPILVWIYGGGYMSGTATLDLYKADIMASSS
DVIVASMQYRVGAFGFLYLNKFFSPGSEEAPGNMGLWDQQLAIRWIKDNA
RVFGGDPDLITLFGESAGGGSVSLHMLSPEMKGLFKRGILQSGTLNAPWS
WMTGERAQDIGKVLVDDCNCNSSLLSADPSLVMDCMRGVDAKTISVQQWN
SYTGILGFPSAPTVDGVFLPKDPDTMMKEGSIHNTEVLLGSNQDEGTYFL
LYDFLDYFEKDGPSFLQREKFLEIINTIFKDFSNIKKEAIIFQYTDWEEI
TDGYLNQKMIADIVSDYFFVCPTNYFAEVLAESGVDVYYYYFTHRTSTSL
WGEWMGVMHGDEMEYVFGHPLNMSLQYHTRERDLAAHIMQSFTRFALTGK
PNKPEEKWPLYSRASPHYYTYTADGTSGPAGPRGPRASACAFWNDFLNRL
NELERVPCDGAVTGPYSSVAGTTLPVVLLTALATTAAL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTCNTKIVITKLLVCFLLSGVRGRSWASHHDTTTSTTQTTPTTSPAPKNF
HNDPLVVETKSGLVKGYAKTVMGREVHIFTGIPFAKPPLGPLRFRKPVPI
EPWHGVLDATAMPNSCYQERYEYFPGFEGEEMWNPNTNISEDCLYLNIWV
PQHLRVRHHQDKPLAERPKVPILVWIYGGGYMSGTATLDLYKADIMASSS
DVIVASMQYRVGAFGFLYLNKFFSPGSEEAPGNMGLWDQQLAIRWIKDNA
RVFGGDPDLITLFGESAGGGSVSLHMLSPEMKGLFKRGILQSGTLNAPWS
WMTGERAQDIGKVLVDDCNCNSSLLSADPSLVMDCMRGVDAKTISVQQWN
SYTGILGFPSAPTVDGVFLPKDPDTMMKEGSIHNTEVLLGSNQDEGTYFL
LYDFLDYFEKDGPSFLQREKFLEIINTIFKDFSNIKKEAIIFQYTDWEEI
TDGYLNQKMIADIVSDYFFVCPTNYFAEVLAESGVDVYYYYFTHRTSTSL
WGEWMGVMHGDEMEYVFGHPLNMSLQYHTRERDLAAHIMQSFTRFALTGK
PNKPEEKWPLYSRASPHYYTYTADGTSGPAGPRGPRASACAFWNDFLNRL
NELERVPCDGAVTGPYSSVAGTTLPVVLLTALATTAAL


References
    Title: Tools for resistance monitoring in oriental fruit moth (Lepidoptera: Tortricidae) and first assessment in Brazilian populations
    Siegwart M, Monteiro LB, Maugin S, Olivares J, Malfitano Carvalho S, Sauphanor B
    Ref: J Econ Entomol, 104:636, 2011 : PubMed

            

    Title: Acetylcholinesterase mutation in an insecticide-resistant population of the codling moth Cydia pomonella (L.)
    Cassanelli S, Reyes M, Rault M, Carlo Manicardi G, Sauphanor B
    Ref: Insect Biochemistry & Molecular Biology, 36:642, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer