Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: erisi-a0a7d5ly28

Eriocheir sinensis juvenile hormone esterase 1 (JHE1) CXE5

Relationship
Family|Carb_B_Arthropoda
Block| C
Position in NCBI Life Tree|Eriocheir sinensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Crustacea: N E > Multicrustacea: N E > Malacostraca: N E > Eumalacostraca: N E > Eucarida: N E > Decapoda: N E > Pleocyemata: N E > Brachyura: N E > Eubrachyura: N E > Thoracotremata: N E > Grapsoidea: N E > Varunidae: N E > Eriocheir: N E > Eriocheir sinensis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





1 substrate:
Methyl-farnesoate
No inhibitor
2 Genbank : MN849872, QLH02005
1 UniProt : A0A7D5LY28
1 UniProt : A0A7D5LY28
1 Interpro : A0A7D5LY28
1 Prodom : A0A7D5LY28
1 Pfam : A0A7D5LY28
1 PIRSF : A0A7D5LY28
1 SUPERFAM : A0A7D5LY28
Sequence
Graphical view for this peptide sequence: erisi-a0a7d5ly28
Colored MSA for Carb_B_Arthropoda (raw)
MRCVGCLVVAMVVVATGGASAKEVPFVDTEGGRVSGILEETEKGRDFHSF
YGIPFAQPPLGKLRFKDPQTPAPWEGTRDASQPPAMCLQNHFINIYAGKT
DFTGGEDCLYLNVFTPEVKEGSDLPVMVWIHGGGFHAGSATEYRPHVLLD
HDVVLVAVQYRLGVLGFLSTEDSVMPGNLGLKDQTMALQWVQRNIHRFGG
DKTRVTIFGESAGGASVHYQMLTPKAEGLFSRAILQSGNALCPWAVNAKP
RETALRVAGFVGCPADQGSQALLGCLQGLDANVIAPLLHKFSRWSRMPLT
FVPWVDGEYLPEHPAQLVLDGRHAQVEIMSGVTRDEGGLFALPVLRKKVL
LEQLSTNFSVTGPTSLSLDGLCEDPVAVARQVYLHYFDTIHLTEAHAESL
NRMFSDHMFAVSHDLTTAFHASHLHPDKKTFRYELQHYRPGAGSHLICPS
CDVVWISHTDELFYLFRGFPFLTLPPDWQQDLQRPEDLSLRDIMTTLWTN
FAATGNPTPDDSLGFNWEPSTADNLHYLSLTPSPSMQPDNREEARKFFNS
LPMTANLILHPHLVADHTGDTSGAAHTSKVEL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRCVGCLVVAMVVVATGGASAKEVPFVDTEGGRVSGILEETEKGRDFHSF
YGIPFAQPPLGKLRFKDPQTPAPWEGTRDASQPPAMCLQNHFINIYAGKT
DFTGGEDCLYLNVFTPEVKEGSDLPVMVWIHGGGFHAGSATEYRPHVLLD
HDVVLVAVQYRLGVLGFLSTEDSVMPGNLGLKDQTMALQWVQRNIHRFGG
DKTRVTIFGESAGGASVHYQMLTPKAEGLFSRAILQSGNALCPWAVNAKP
RETALRVAGFVGCPADQGSQALLGCLQGLDANVIAPLLHKFSRWSRMPLT
FVPWVDGEYLPEHPAQLVLDGRHAQVEIMSGVTRDEGGLFALPVLRKKVL
LEQLSTNFSVTGPTSLSLDGLCEDPVAVARQVYLHYFDTIHLTEAHAESL
NRMFSDHMFAVSHDLTTAFHASHLHPDKKTFRYELQHYRPGAGSHLICPS
CDVVWISHTDELFYLFRGFPFLTLPPDWQQDLQRPEDLSLRDIMTTLWTN
FAATGNPTPDDSLGFNWEPSTADNLHYLSLTPSPSMQPDNREEARKFFNS
LPMTANLILHPHLVADHTGDTSGAAHTSKVEL


Reference
    Title: Identification, characterization and mRNA transcript abundance profiles of the carboxylesterase (CXE5) gene in Eriocheir sinensis suggest that it may play a role in methyl farnesoate degradation
    Li X, Chen T, Xu R, Huang M, Huang J, Xie Q, Liu F, Su S, Ma K
    Ref: Comparative Biochemistry & Physiology B Biochem Mol Biol, :110630, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer