Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: geotd-g3jwz2

Geobacillus thermodenitrificans, Geobacillus sp. Esterase EstGtA2

Comment
Other strains: Geobacillus thermodenitrificans (strain NG80-2), Geobacillus sp. G11MC16 This esterase belongs to family_XIII of the Arpigny and Jaeger classification. Charbonneau et al. showed that this family is composed of two sub families with different set of salt-bridges important for thermostability Charbonneau et al. (due to simultaneous publication of new families this family was numbered XV but really is a subset of familly XIII)


Relationship
Family|CarbLipBact_2
Block| X
Position in NCBI Life Tree|Geobacillus thermodenitrificans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Bacillales: N E > Bacillaceae: N E > Geobacillus: N E > Geobacillus thermodenitrificans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AEN92268, CP000557, ABVH01000004
2 UniProt : G3JWZ2, A4IP20
2 UniProt : G3JWZ2, A4IP20
2 Interpro : G3JWZ2, A4IP20
2 Pfam : G3JWZ2, A4IP20
2 PIRSF : G3JWZ2, A4IP20
2 SUPERFAM : G3JWZ2, A4IP20
Sequence
Graphical view for this peptide sequence: geotd-g3jwz2
Colored MSA for CarbLipBact_2 (raw)
MKERYPVLPGAEPFYAENGPVGVLLSHGFTGTPYSMRPLAEAYAQAGYTV
CLPRLKGHGTHYEDMERTTFHDWIASVEEGYEWLKQRCQTIFVTGLSMGG
TLTLYLAEQHPEICGIVPINAAVDIPAIAAGMTGGGEVPRYLDSIGSDLK
NPDVKELSYEKTPTASLLQLAQLMERVKEELGRITCPALIFVSDEDHVVP
PGNADIIFQGVQSSEKEIVRLHNSYHVATLDYDQQTIIERSLQFFAKHA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKERYPVLPGAEPFYAENGPVGVLLSHGFTGTPYSMRPLAEAYAQAGYTV
CLPRLKGHGTHYEDMERTTFHDWIASVEEGYEWLKQRCQTIFVTGLSMGG
TLTLYLAEQHPEICGIVPINAAVDIPAIAAGMTGGGEVPRYLDSIGSDLK
NPDVKELSYEKTPTASLLQLAQLMERVKEELGRITCPALIFVSDEDHVVP
PGNADIIFQGVQSSEKEIVRLHNSYHVATLDYDQQTIIERSLQFFAKHA


References
2 more
    Title: Efficient monoacylglycerol synthesis by carboxylesterase EstGtA2 from Geobacillus thermodenitrificans in a solvent-free two-phase system
    Osamura T, Nonaka K, Takahashi F, Okuda M, Hagihara H, Takimura Y
    Ref: J Biosci Bioeng, :, 2022 : PubMed

            

    Title: Role of key salt bridges in thermostability of G. thermodenitrificans EstGtA2: distinctive patterns within the new bacterial lipolytic enzyme family XV
    Charbonneau DM, Beauregard M
    Ref: PLoS ONE, 8:e76675, 2013 : PubMed

            

    Title: Genome and proteome of long-chain alkane degrading Geobacillus thermodenitrificans NG80-2 isolated from a deep-subsurface oil reservoir
    Feng L, Wang W, Cheng J, Ren Y, Zhao G, Gao C, Tang Y, Liu X, Han W and Wang L <2 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 104:5602, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer