Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: giaic-a8bnj4

Giardia intestinalis (strains ATCC 50803 / WB clone C6; ATCC 50581 / GS clone H7) (Giardia lamblia) ENC6 protein

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Giardia intestinalis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Fornicata: N E > Diplomonadida: N E > Hexamitidae: N E > Giardiinae: N E > Giardia: N E > Giardia intestinalis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AACB02000028, ACGJ01002913
2 UniProt : A8BNJ4, C6LYK6
2 UniProt : A8BNJ4, C6LYK6
2 Interpro : A8BNJ4, C6LYK6
2 Pfam : A8BNJ4, C6LYK6
2 PIRSF : A8BNJ4, C6LYK6
2 SUPERFAM : A8BNJ4, C6LYK6
Sequence
Graphical view for this peptide sequence: giaic-a8bnj4
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MHALNQDCFTTISVPSVEKLRVFHSIPHGIDNPPRLLFLHGYSFFTDLYA
TLLNELCTHFEVLAFDSPGTGGSGPIFDGDYTVNSLVEVALELLTISQLR
WVPRAASVLYKANMKYDPDKMLDSQSGEDRQLAESLVESLALSTDRKKFT
IVGHSMGAFLAAELTVACWNCVEAVYMVAPAGIKCELKNFWSDLCGGALG
IFRRAYAKLRHKQTIEKWVAIQQDSLAQGRSVTHAEQMQRDFSEAYLANS
KAAVSRFCCLVDFPWSNGHDVFRELESIIEKKGLNAYCYLMEQDEIISYK
DVSAFFRDIMPNCRLHTVSAANHDWVNDHPHLLVHNIINDRAHLTAATSS
VEI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MHALNQDCFTTISVPSVEKLRVFHSIPHGIDNPPRLLFLHGYSFFTDLYA
TLLNELCTHFEVLAFDSPGTGGSGPIFDGDYTVNSLVEVALELLTISQLR
WVPRAASVLYKANMKYDPDKMLDSQSGEDRQLAESLVESLALSTDRKKFT
IVGHSMGAFLAAELTVACWNCVEAVYMVAPAGIKCELKNFWSDLCGGALG
IFRRAYAKLRHKQTIEKWVAIQQDSLAQGRSVTHAEQMQRDFSEAYLANS
KAAVSRFCCLVDFPWSNGHDVFRELESIIEKKGLNAYCYLMEQDEIISYK
DVSAFFRDIMPNCRLHTVSAANHDWVNDHPHLLVHNIINDRAHLTAATSS
VEI


References
    Title: Draft genome sequencing of giardia intestinalis assemblage B isolate GS: is human giardiasis caused by two different species?
    Franzen O, Jerlstrom-Hultqvist J, Castro E, Sherwood E, Ankarklev J, Reiner DS, Palm D, Andersson JO, Andersson B, Svard SG
    Ref: PLoS Pathog, 5:e1000560, 2009 : PubMed

            

    Title: Genomic minimalism in the early diverging intestinal parasite Giardia lamblia
    Morrison HG, McArthur AG, Gillin FD, Aley SB, Adam RD, Olsen GJ, Best AA, Cande WZ, Chen F and Sogin ML <19 more author(s)>
    Ref: Science, 317:1921, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer