Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lacpl-LP.1760

Lactobacillus plantarum lipase/esterase (putative)

Comment
Other strains: Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1)


Relationship
Family|yjfP_esterase-like
Block| X
Position in NCBI Life Tree|Lactobacillus plantarum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Lactobacillaceae: N E > Lactobacillus: N E > Lactobacillus plantarum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AL935257, WP_003645075, CCC79051
1 UniProt : F9UPB2
1 Interpro : F9UPB2
1 Pfam : F9UPB2
1 PIRSF : F9UPB2
1 SUPERFAM : F9UPB2
Sequence
Graphical view for this peptide sequence: lacpl-LP.1760
Colored MSA for yjfP_esterase-like (raw)
MIKVTNRHFQDVPALEVVTTTHLDQPLPLVIFYHGWQSNKELVLTQARKL
ARKNLRVVLPDAMNHGERHQIVSQIPSFTFWNSIQGNLGEFELIVNYYRE
RKLILNEQIGVGGYSMGGMTTGALLTHHPEIKAATIIMGTPNLNAYAQLV
RKHAQAHAYYIPSDLALLTSWLDHYDLNLQPETINHRPLLFWHGTEDERI
PYSQSRNFFDRVHTAPYAEQVAFITGYQAKHLVKVPLMNKVANFFDYYLN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MIKVTNRHFQDVPALEVVTTTHLDQPLPLVIFYHGWQSNKELVLTQARKL
ARKNLRVVLPDAMNHGERHQIVSQIPSFTFWNSIQGNLGEFELIVNYYRE
RKLILNEQIGVGGYSMGGMTTGALLTHHPEIKAATIIMGTPNLNAYAQLV
RKHAQAHAYYIPSDLALLTSWLDHYDLNLQPETINHRPLLFWHGTEDERI
PYSQSRNFFDRVHTAPYAEQVAFITGYQAKHLVKVPLMNKVANFFDYYLN


References
    Title: Production and characterization of a tributyrin esterase from Lactobacillus plantarum suitable for cheese lipolysis
    Esteban-Torres M, Mancheno JM, de Las Rivas B, Munoz R
    Ref: J Dairy Sci, 97:6737, 2014 : PubMed

            

    Title: Complete genome sequence of Lactobacillus plantarum WCFS1
    Kleerebezem M, Boekhorst J, van Kranenburg R, Molenaar D, Kuipers OP, Leer R, Tarchini R, Peters SA, Sandbrink HM and Siezen RJ <10 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 100:1990, 2003 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer