Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: lacpl-tanL

Lactobacillus plantarum Tannase (Tannin acylhydrolase) LP.2956 tanL TanBLp

Comment
Other strains: Lactobacillus plantarum (strains ATCC BAA-793 / NCIMB 8826 / WCFS1; ST-III; subsp. plantarum NC8; subsp. plantarum ATCC 14917; JDM1)


Relationship
Family|Tannase_Bact
Block| H
Position in NCBI Life Tree|Lactobacillus plantarum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Lactobacillaceae: N E > Lactobacillus: N E > Lactobacillus plantarum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
10 structures (e.g. : 3WA6, 3WA7, 4J0C... more)
No kinetic





2 substrates: 1,3,6-Trigalloylglucose, Ethyl-Gallate
2 inhibitors: 3,4-dihydroxybenzoate, Gallate
>3 Genbank links 5 more: AL935260, AL935263, AB379685
>3 UniProt links 1 more: F9US92, B3Y018, D7VD10
>3 Structure links 7 more: 4J0J, 4J0K, 4J0C
>3 UniProt links 1 more: F9US92, B3Y018, D7VD10
>3 Interpro links 1 more: F9US92, B3Y018, D7VD10
>3 Pfam links 1 more: F9US92, B3Y018, D7VD10
>3 PIRSF links 1 more: F9US92, B3Y018, D7VD10
>3 SUPERFAM links 1 more: F9US92, B3Y018, D7VD10
Sequence
Graphical view for this peptide sequence: lacpl-tanL
Colored MSA for Tannase_Bact (raw)
MSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVP
AAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQ
ALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRL
PGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAV
SAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGRPKFEPVSGQL
TVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLL
ISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQ
LDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYL
TTTSSRVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIP
HSGDYDLGDLFSWIDGLCQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSNRLIFDADWLVPEQVQVAGQAIQYYAARNIQYVQHPVAAIQVLNVFVP
AAYLHGSSVNGYQRATAPILMPNTVGGYLPGPADDPQRVTWPTNAGTIQQ
ALKRGYVVVAAGIRGRTTVDKSGQRVGQAPAFIVDMKAAIRYVKYNQGRL
PGDANRIITNGTSAGGATSALAGASGNSAYFEPALTALGAAPATDDIFAV
SAYCPIHNLEHADMAYEWQFNGINDWHRYQPVAGTTKNGRPKFEPVSGQL
TVEEQALSLALKAQFSTYLNQLKLTASDGTHLTLNEAGMGSFRDVVRQLL
ISSAQTAFDQGTDIHKYAGFVVTGNQVTDLDLSAYLKSLTRMKAVPAFDQ
LDLTSPENNLFGDATAKAKHFTALAQTRSTVTAQLADAELIQAINPLSYL
TTTSSRVAKHWRIRHGAADRDTSFAIPIILAIMLENHGYGIDFALPWDIP
HSGDYDLGDLFSWIDGLCQ


References
5 more
    Title: Crystallographic and mutational analyses of tannase from Lactobacillus plantarum
    Matoba Y, Tanaka N, Noda M, Higashikawa F, Kumagai T, Sugiyama M
    Ref: Proteins, 81:2052, 2013 : PubMed

            

    Title: Crystal structure of tannase from lactobacillusplantarum
    Ren B, Wu M, Wang Q, Peng X, Wen H, McKinstry WJ, Chen Q
    Ref: Journal of Molecular Biology, 425:2737, 2013 : PubMed

            

    Title: Expression, purification, crystallization and preliminary X-ray analysis of tannase from Lactobacillus plantarum.
    Wu M, Peng X, Wen H, Wang Q, Chen Q, McKinstry WJ, Ren B
    Ref: Acta Crystallographica Sect F Struct Biol Cryst Commun, 69:456, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer