Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: malgo-a8pwr6

Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) (Dandruff-associated fungus) Putative uncharacterized protein

Relationship
Family|Duf_1749
Block| X
Position in NCBI Life Tree|Malassezia globosa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Basidiomycota: N E > Ustilaginomycotina: N E > Malasseziomycetes: N E > Malasseziales: N E > Malasseziaceae: N E > Malassezia: N E > Malassezia globosa: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AAYY01000003
1 UniProt : A8PWR6
1 UniProt : A8PWR6
1 Interpro : A8PWR6
1 Pfam : A8PWR6
1 PIRSF : A8PWR6
1 SUPERFAM : A8PWR6
Sequence
Graphical view for this peptide sequence: malgo-a8pwr6
Colored MSA for Duf_1749 (raw)
MTPAPLQGVLRLYQIKPIALPYFETNAHHSNKLVFVPGLTDTIGVVPYLP
RLASVIDEVGFSLVQFVKCSDLGGFGTSSLEGDAQEIAQLLEHLITRSDS
PCTGKLVVMGHSTGCQDVVAFLSRERRLLSGRDGPIRVHGGICQAPVSDR
EYFDAHDGQNPLGQLQLAESRAYIAEGKPGTLLERSSIAQTPRYTDNGRG
DGNSASALQPAMTAYRFTSLNARGGDDDLFSTDLRQDELQRTLGPALERA
PLLMLFGANECVFQCHCLY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTPAPLQGVLRLYQIKPIALPYFETNAHHSNKLVFVPGLTDTIGVVPYLP
RLASVIDEVGFSLVQFVKCSDLGGFGTSSLEGDAQEIAQLLEHLITRSDS
PCTGKLVVMGHSTGCQDVVAFLSRERRLLSGRDGPIRVHGGICQAPVSDR
EYFDAHDGQNPLGQLQLAESRAYIAEGKPGTLLERSSIAQTPRYTDNGRG
DGNSASALQPAMTAYRFTSLNARGGDDDLFSTDLRQDELQRTLGPALERA
PLLMLFGANECVFQCHCLY


Reference
    Title: Dandruff-associated Malassezia genomes reveal convergent and divergent virulence traits shared with plant and human fungal pathogens
    Xu J, Saunders CW, Hu P, Grant RA, Boekhout T, Kuramae EE, Kronstad JW, Deangelis YM, Reeder NL and Dawson TL, Jr. <11 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 104:18730, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer