Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: medtr-q71ce5

Medicago truncatula (Barrel medic) lecithine cholesterol acyltransferase-like protein

Relationship
Family|PC-sterol_acyltransferase
Block| L
Position in NCBI Life Tree|Medicago truncatula
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Fabales: N E > Fabaceae: N E > Papilionoideae: N E > Trifolieae: N E > Medicago: N E > Medicago truncatula: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AF533771
1 UniProt : Q71CE5
1 UniProt : Q71CE5
1 Interpro : Q71CE5
1 Pfam : Q71CE5
1 PIRSF : Q71CE5
1 SUPERFAM : Q71CE5
Sequence
Graphical view for this peptide sequence: medtr-q71ce5
Colored MSA for PC-sterol_acyltransferase (raw)
MKEHSLKICITNTLTLLVMVSLICCTNVAVSTSNNNLNPVILIPGNGGNQ
LEAKLTTKYKPSTLICDPWYPPFKKKNGWFRLWFDSSVLLAPFTKCFASR
MTLYYDQDLDDYFNVPGVETRVPSFGSTSSLLYLNPRLKLVTGYMAPLVE
SLEQLGYIDGQNLFGAPYDFRYGLAAPSHPSQVGSKFLNDLKNLIEKASN
SNGGKPVILVSHSLGGLFVLELLNRNPSSWRKKFIKHFIALSAPWGGTVD
EMFTSASGNTLGVPLVNPLIVRNEQRTSESNLWLLPNPKMFDIDKSLVTT
PYRNYSAHDMIDFLKDIGFPEGVYPYETRILPLIAKIDAPAVAMTCIIGK
GVKTPEELFYRNGDFDEPPEFSYGDGDGTVNMVSLLALESLWKDEKNQYL
KVIKIGGVTHTSILKDKVALDPIIGEISRINSHAQLGLSNISLATFDEK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKEHSLKICITNTLTLLVMVSLICCTNVAVSTSNNNLNPVILIPGNGGNQ
LEAKLTTKYKPSTLICDPWYPPFKKKNGWFRLWFDSSVLLAPFTKCFASR
MTLYYDQDLDDYFNVPGVETRVPSFGSTSSLLYLNPRLKLVTGYMAPLVE
SLEQLGYIDGQNLFGAPYDFRYGLAAPSHPSQVGSKFLNDLKNLIEKASN
SNGGKPVILVSHSLGGLFVLELLNRNPSSWRKKFIKHFIALSAPWGGTVD
EMFTSASGNTLGVPLVNPLIVRNEQRTSESNLWLLPNPKMFDIDKSLVTT
PYRNYSAHDMIDFLKDIGFPEGVYPYETRILPLIAKIDAPAVAMTCIIGK
GVKTPEELFYRNGDFDEPPEFSYGDGDGTVNMVSLLALESLWKDEKNQYL
KVIKIGGVTHTSILKDKVALDPIIGEISRINSHAQLGLSNISLATFDEK


Reference
    Title: Expression in yeast of a novel phospholipase A1 cDNA from Arabidopsis thaliana
    Noiriel A, Benveniste P, Banas A, Stymne S, Bouvier-Nave P
    Ref: European Journal of Biochemistry, 271:3752, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer