arath-At5g13640

Arabidopsis thaliana (Mouse-ear cress) Arabidopsis lyrata subsp. lyrata (Lyre-leaved rock-cress) at5g13640/msh12_10 Phospholipid:diacylglycerol acyltransferase 1 PDAT1

Comment

Relationship

Family : PC-sterol_acyltransferase

Block : L

Position in NCBI Life Tree : Arabidopsis thaliana

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MPLIHRKKPTEKPSTPPSEEVVHDEDSQKKPHESSKSHHK
KSNGGGKWSC IDSCCWFIGCVCVTWWFLLFLYNAMPASF
PQYVTERITGPLPDPPGVKLK KEGLKAKHPVVFIPGIVT
GGLELWEGKQCADGLFRKRLWGGTFGEVYKRP LCWVEHM
SLDNETGLDPAGIRVRAVSGLVAADYFAPGYFVWAVLIAN
LAH IGYEEKNMYMAAYDWRLSFQNTEVRDQTLSRMKSNI
ELMVSTNGGKKAVI VPHSMGVLYFLHFMKWVEAPAPLGG
GGGPDWCAKYIKAVMNIGGPFLGVP KAVAGLFSAEAKDV
AVARAIAPGFLDTDIFRLQTLQHVMRMTRTWDSTMS MLP
KGGDTIWGGLDWSPEKGHTCCGKKQKNNETCGEAGENGVS
KKSPVNY GRMISFGKEVAEAAPSEINNIDFRGAVKGQSI
PNHTCRDVWTEYHDMGIA GIKAIAEYKVYTAGEAIDLLH
YVAPKMMARGAAHFSYGIADDLDDTKYQD PKYWSNPLET
KLPNAPEMEIYSLYGVGIPTERAYVYKLNQSPDSCIPFQI
FTSAHEEDEDSCLKAGVYNVDGDETVPVLSAGYMCAKAW
RGKTRFNPSGI KTYIREYNHSPPANLLEGRGTQSGAHVD
IMGNFALIEDIMRVAAGGNGSD IGHDQVHSGIFEWSERI
DLKL

References

Title : Phospholipid:diacylglycerol acyltransferase1-overexpression stimulates lipid turnover, oil production and fitness in cold-grown plants - Klinska-Bachor_2023_BMC.Plant.Biol_23_370
Author(s) : Klinska-Bachor S , Kedzierska S , Demski K , Banas A
Ref : BMC Plant Biol , 23 :370 , 2023
Abstract : Klinska-Bachor_2023_BMC.Plant.Biol_23_370
ESTHER : Klinska-Bachor_2023_BMC.Plant.Biol_23_370
PubMedSearch : Klinska-Bachor_2023_BMC.Plant.Biol_23_370
PubMedID: 37491206
Gene_locus related to this paper: arath-At5g13640

Title : The Plastid Lipase PLIP1 Is Critical for Seed Viability in diacylglycerol acyltransferase1 Mutant Seed - Aulakh_2019_Plant.Physiol_180_1962
Author(s) : Aulakh K , Durrett TP
Ref : Plant Physiol , 180 :1962 , 2019
Abstract : Aulakh_2019_Plant.Physiol_180_1962
ESTHER : Aulakh_2019_Plant.Physiol_180_1962
PubMedSearch : Aulakh_2019_Plant.Physiol_180_1962
PubMedID: 31221730
Gene_locus related to this paper: arath-At3g61680 , arath-At5g13640

Title : The Arabidopsis lyrata genome sequence and the basis of rapid genome size change - Hu_2011_Nat.Genet_43_476
Author(s) : Hu TT , Pattyn P , Bakker EG , Cao J , Cheng JF , Clark RM , Fahlgren N , Fawcett JA , Grimwood J , Gundlach H , Haberer G , Hollister JD , Ossowski S , Ottilar RP , Salamov AA , Schneeberger K , Spannagl M , Wang X , Yang L , Nasrallah ME , Bergelson J , Carrington JC , Gaut BS , Schmutz J , Mayer KF , Van de Peer Y , Grigoriev IV , Nordborg M , Weigel D , Guo YL
Ref : Nat Genet , 43 :476 , 2011
Abstract : Hu_2011_Nat.Genet_43_476
ESTHER : Hu_2011_Nat.Genet_43_476
PubMedSearch : Hu_2011_Nat.Genet_43_476
PubMedID: 21478890
Gene_locus related to this paper: arall-d7kc59 , arall-d7kfz1 , arall-d7kjk9 , arall-d7kk58 , arall-d7kuj1 , arall-d7kwx5 , arall-d7kzq8 , arall-d7laf7 , arall-D7LAK6 , arall-d7ltj2 , arall-d7lu11 , arall-d7ly06 , arall-d7lyn6 , arall-d7m1k0 , arall-d7m1k1 , arall-d7m1k3 , arall-d7m1l4 , arall-d7m814 , arall-d7mbk0 , arall-d7mbn8 , arall-d7mgs1 , arall-d7mi04 , arall-d7mld7 , arall-d7mpg7 , arall-d7mul9 , arath-At2g45610 , arath-At1g05790 , arath-At1g09980 , arath-At1g18360 , arath-AT1G29120 , arath-AT1G73920 , arath-AT1G76140 , arath-AT2G05260 , arath-At2g15230 , arath-At2g24280 , arath-AT2G42690 , arath-At2g47630 , arath-AT3G12150 , arath-At3g61680 , arath-AT3g62590 , arath-AT4G00500 , arath-AT4G25770 , arath-AT4g30610 , arath-At5g11650 , arath-At5g13640 , arath-AT5G19050 , arath-AT5G20060 , arath-AT5G20520 , arath-AT5G27320 , arath-At5g42930 , arath-At5g47330 , arath-CGEP , arath-clh1 , arath-clh2 , arath-F1N13.220 , arath-F2G14.100 , arath-F12A4.4 , arath-F14O10.2 , arath-SCP27 , arath-HNL , arath-GID1B , arath-LIP2 , arath-At5g17670 , arath-pip , arath-PLA11 , arath-PLA12 , arath-PLA13 , arath-PLA15 , arath-PLA17 , arath-Q8LPF5 , arath-Q9FFZ1 , arath-Q9FJ29 , arath-Q9FKP9 , arath-Q9FNF6 , arath-q9lhe8 , arath-Q9SFF6 , arath-q84w08 , arath-SCP7 , arath-SCP8 , arath-SCP26 , arath-SCP28 , arath-SCP33 , arath-SCP40 , arath-SCPL34 , arath-At4g12230 , arath-MES14 , arath-T19F11.2 , arath-MES10 , arath-At5g11790 , arath-T26B15.8 , arath-ZW18 , arall-d7l971 , arall-d7lfd3 , arall-d7lg04 , arall-d7lg05 , arall-d7lg06 , arall-d7lg07 , arall-d7mb17 , arall-d7mb18 , arall-d7l7v2 , arall-d7l7v3 , arall-d7lst0 , arall-d7lfw9 , arall-d7mgs6 , arall-d7mur3 , arall-d7kjr5 , arall-d7l7v1 , arall-d7ls88 , arall-d7kzg6 , arall-d7kcm6 , arall-d7krm0 , arall-d7kwe4 , arall-d7lri7 , arall-d7kq26

Title : DGAT1, DGAT2 and PDAT expression in seeds and other tissues of epoxy and hydroxy fatty acid accumulating plants - Li_2010_Lipids_45_145
Author(s) : Li R , Yu K , Hildebrand DF
Ref : Lipids , 45 :145 , 2010
Abstract : Li_2010_Lipids_45_145
ESTHER : Li_2010_Lipids_45_145
PubMedSearch : Li_2010_Lipids_45_145
PubMedID: 20101470
Gene_locus related to this paper: arath-At5g13640

Title : DGAT1 and PDAT1 acyltransferases have overlapping functions in Arabidopsis triacylglycerol biosynthesis and are essential for normal pollen and seed development - Zhang_2009_Plant.Cell_21_3885
Author(s) : Zhang M , Fan J , Taylor DC , Ohlrogge JB
Ref : Plant Cell , 21 :3885 , 2009
Abstract : Zhang_2009_Plant.Cell_21_3885
ESTHER : Zhang_2009_Plant.Cell_21_3885
PubMedSearch : Zhang_2009_Plant.Cell_21_3885
PubMedID: 20040537
Gene_locus related to this paper: arath-At5g13640

Title : Isolation and characterization of an Arabidopsis thaliana knockout line for phospholipid: diacylglycerol transacylase gene (At5g13640) - Mhaske_2005_Plant.Physiol.Biochem_43_413
Author(s) : Mhaske V , Beldjilali K , Ohlrogge J , Pollard M
Ref : Plant Physiol Biochem , 43 :413 , 2005
Abstract : Mhaske_2005_Plant.Physiol.Biochem_43_413
ESTHER : Mhaske_2005_Plant.Physiol.Biochem_43_413
PubMedSearch : Mhaske_2005_Plant.Physiol.Biochem_43_413
PubMedID: 15907694
Gene_locus related to this paper: arath-At5g13640

Title : Expression in yeast of a novel phospholipase A1 cDNA from Arabidopsis thaliana - Noiriel_2004_Eur.J.Biochem_271_3752
Author(s) : Noiriel A , Benveniste P , Banas A , Stymne S , Bouvier-Nave P
Ref : European Journal of Biochemistry , 271 :3752 , 2004
Abstract : Noiriel_2004_Eur.J.Biochem_271_3752
ESTHER : Noiriel_2004_Eur.J.Biochem_271_3752
PubMedSearch : Noiriel_2004_Eur.J.Biochem_271_3752
PubMedID: 15355352
Gene_locus related to this paper: arath-At5g13640 , arath-LCAT1 , arath-LCAT4 , arath-LCAT3 , lyces-q71lx7 , medtr-q6xsh3 , medtr-Q8GZM5 , medtr-q71ce5 , tobac-q71lw1

Title : Cloning and functional characterization of a phospholipid:diacylglycerol acyltransferase from Arabidopsis - Stahl_2004_Plant.Physiol_135_1324
Author(s) : Stahl U , Carlsson AS , Lenman M , Dahlqvist A , Huang B , Banas W , Banas A , Stymne S
Ref : Plant Physiol , 135 :1324 , 2004
Abstract : Stahl_2004_Plant.Physiol_135_1324
ESTHER : Stahl_2004_Plant.Physiol_135_1324
PubMedSearch : Stahl_2004_Plant.Physiol_135_1324
PubMedID: 15247387
Gene_locus related to this paper: arath-At5g13640

Title : Structural analysis of Arabidopsis thaliana chromosome 5. II. Sequence features of the regions of 1,044,062 bp covered by thirteen physically assigned P1 clones - Kotani_1997_DNA.Res_4_291
Author(s) : Kotani H , Nakamura Y , Sato S , Kaneko T , Asamizu E , Miyajima N , Tabata S
Ref : DNA Research , 4 :291 , 1997
Abstract : Kotani_1997_DNA.Res_4_291
ESTHER : Kotani_1997_DNA.Res_4_291
PubMedSearch : Kotani_1997_DNA.Res_4_291
PubMedID: 9405937
Gene_locus related to this paper: arath-At5g13640 , arath-AT5G24210 , arath-At5g24220 , arath-AT5G24230 , arath-At5g17670 , arath-Q9FN74 , arath-Q9FN79 , arath-Q9FNF6