Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: miclu-d3lls7

Micrococcus luteus (Micrococcus lysodeikticus); Burkholderia sp. Esterase/lipase family protein

Comment
Other strains: Micrococcus luteus (SK58; ATCC 4698 / DSM 20030 / JCM 1464 / NBR 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230; trpE16); Burkholderia sp. 2385


Relationship
Family|CarbLipBact_2
Block| X
Position in NCBI Life Tree|Micrococcus luteus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Micrococcales: N E > Micrococcaceae: N E > Micrococcus: N E > Micrococcus luteus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: miclu-d3lls7
Colored MSA for CarbLipBact_2 (raw)
MPRPVAVAPEDLPLRLMPAAPARRDHCVVLLHGFTSTPASVRAWAEGLAA
GGSPVSVPLLPGHGTRWEDLAATGADEIRAAVRAVVDLELARHGRVVMAG
ISMGGALALDAAAHRPVAGVLVVNPALRFASPLAPFAPLLAPFVPTIAPI
ADDIADPTARERAYPRTPMAGVAALGRIQRAARRALPRITAPVTVYRSAR
DAVVPASSHRTLVRGLRHAPVEVVGLPRSRHVATLDYDLPLLIDHGRSAV
AAMTTH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPRPVAVAPEDLPLRLMPAAPARRDHCVVLLHGFTSTPASVRAWAEGLAA
GGSPVSVPLLPGHGTRWEDLAATGADEIRAAVRAVVDLELARHGRVVMAG
ISMGGALALDAAAHRPVAGVLVVNPALRFASPLAPFAPLLAPFVPTIAPI
ADDIADPTARERAYPRTPMAGVAALGRIQRAARRALPRITAPVTVYRSAR
DAVVPASSHRTLVRGLRHAPVEVVGLPRSRHVATLDYDLPLLIDHGRSAV
AAMTTH


Reference
    Title: Novel Flp pilus biogenesis-dependent natural transformation
    Angelov A, Bergen P, Nadler F, Hornburg P, Lichev A, Ubelacker M, Pachl F, Kuster B, Liebl W
    Ref: Front Microbiol, 6:84, 2015 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer