Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: myca9-b1mg17

Mycobacteroides abscessus (Mycobacterium abscessus) MetA metXA Homoserine O-acetyltransferase

Comment
Other strains: Mycobacteroides abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) (Mycobacterium abscessus)


Relationship
Family|Homoserine_transacetylase
Block| X
Position in NCBI Life Tree|Mycobacteroides abscessus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Mycobacteriaceae: N E > Mycobacterium chelonae group: N E > Mycobacterium abscessus: N E


Molecular evidence
Database
No mutation
1 structure:
5W8P: Homoserine transacetylase MetA from Mycobacterium abscessus
No kinetic





No Substrate
No inhibitor
1 Genbank : CAM63762
1 UniProt : B1MG17
1 Structure : 5W8P
1 UniProt : B1MG17
1 Interpro : B1MG17
1 Prodom : B1MG17
1 Pfam : B1MG17
1 PIRSF : B1MG17
1 SUPERFAM : B1MG17
Sequence
Graphical view for this peptide sequence: myca9-b1mg17
Colored MSA for Homoserine_transacetylase (raw)
MTIEQQLPVPHIALPQGDEIAYVPIGSITLESGAVIDDVTIAVQSWGELS
PRRDNVVFVCHALTADSHVVGPAGPDHITGGWWEGIIGPGAAIDTDHWCA
VATNVLGGCRGTTGPTSLARDGKPWGSRFPEVSVRDQVNADVAALAQLGI
TEVAAVVGGSMGGARALEWAVMHPDAVRAALVLAVGARATGDQIGTQSTQ
IAAIQTDPDWQGGDYHGSGRSPGKGLNLARRIAHLTYRGEVELDTRFGND
PQVGPDGPEDPWADGRYAVQSYLEHQGNKFVRRFDAGSYVILTESLNRHD
VGRGRGGVEKALRGCPVPVVVGGITSDRLYPLRLQEELADLLPGCTGLRV
VESVHGHDAFLIEFDAVSELVRETLALAKATQAS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTIEQQLPVPHIALPQGDEIAYVPIGSITLESGAVIDDVTIAVQSWGELS
PRRDNVVFVCHALTADSHVVGPAGPDHITGGWWEGIIGPGAAIDTDHWCA
VATNVLGGCRGTTGPTSLARDGKPWGSRFPEVSVRDQVNADVAALAQLGI
TEVAAVVGGSMGGARALEWAVMHPDAVRAALVLAVGARATGDQIGTQSTQ
IAAIQTDPDWQGGDYHGSGRSPGKGLNLARRIAHLTYRGEVELDTRFGND
PQVGPDGPEDPWADGRYAVQSYLEHQGNKFVRRFDAGSYVILTESLNRHD
VGRGRGGVEKALRGCPVPVVVGGITSDRLYPLRLQEELADLLPGCTGLRV
VESVHGHDAFLIEFDAVSELVRETLALAKATQAS


Reference
    Title: Structural analysis of mycobacterial homoserine transacetylases central to methionine biosynthesis reveals druggable active site
    Chaton CT, Rodriguez ES, Reed RW, Li J, Kenner CW, Korotkov KV
    Ref: Sci Rep, 9:20267, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer