(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Actinobacteria [phylum]: NE > Actinobacteria [class]: NE > Corynebacteriales: NE > Mycobacteriaceae: NE > Mycobacterium: NE > Mycobacterium chelonae group: NE > Mycobacterium abscessus subgroup: NE > Mycobacterium abscessus: NE
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) Mycobacterium abscessus 5S-0921: N, E.
Mycobacterium abscessus 5S-1215: N, E.
Mycobacterium abscessus 5S-1212: N, E.
Mycobacterium abscessus 5S-0422: N, E.
Mycobacterium abscessus 5S-0304: N, E.
Mycobacterium abscessus 5S-0817: N, E.
Mycobacterium abscessus 5S-0421: N, E.
Mycobacterium abscessus 5S-0708: N, E.
Mycobacterium abscessus M94: N, E.
Mycobacterium abscessus 4S-0116-S: N, E.
Mycobacterium abscessus 4S-0726-RB: N, E.
Mycobacterium abscessus 4S-0303: N, E.
Mycobacterium abscessus 4S-0726-RA: N, E.
Mycobacterium abscessus 4S-0206: N, E.
Mycobacterium abscessus 4S-0116-R: N, E.
Mycobacterium abscessus subsp. bolletii CCUG 48898 = JCM 15300: N, E.
Mycobacterium abscessus 6G-0728-S: N, E.
Mycobacterium abscessus ATCC 19977: N, E.
Mycobacterium abscessus 3A-0122-S: N, E.
Mycobacterium abscessus 6G-1108: N, E.
Mycobacterium abscessus 6G-0125-S: N, E.
Mycobacterium abscessus 3A-0930-S: N, E.
Mycobacterium abscessus 3A-0930-R: N, E.
Mycobacterium abscessus 3A-0810-R: N, E.
Mycobacterium abscessus 6G-0125-R: N, E.
Mycobacterium abscessus 3A-0731: N, E.
Mycobacterium abscessus 3A-0122-R: N, E.
Mycobacterium abscessus 3A-0119-R: N, E.
Mycobacterium abscessus 6G-0728-R: N, E.
Mycobacterium abscessus 6G-0212: N, E.
Mycobacterium abscessus M93: N, E.
Mycobacterium abscessus V06705: N, E.
Mycobacterium abscessus subsp. bolletii 50594: N, E.
Mycobacterium abscessus MAB_091912_2446: N, E.
Mycobacterium abscessus MAB_082312_2258: N, E.
Mycobacterium abscessus subsp. bolletii 1S-154-0310: N, E.
Mycobacterium abscessus subsp. bolletii 2B-0626: N, E.
Mycobacterium abscessus subsp. bolletii 1S-152-0914: N, E.
Mycobacterium abscessus subsp. bolletii 2B-0107: N, E.
Mycobacterium abscessus subsp. bolletii 2B-1231: N, E.
Mycobacterium abscessus subsp. bolletii 1S-153-0915: N, E.
Mycobacterium abscessus subsp. bolletii 2B-0912-S: N, E.
Mycobacterium abscessus subsp. bolletii 2B-0307: N, E.
Mycobacterium abscessus subsp. bolletii 2B-0912-R: N, E.
Mycobacterium abscessus subsp. bolletii 1S-151-0930: N, E.
Mycobacterium abscessus 47J26: N, E.
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MPQHRRLTYGDHPSQYVDILEPDEPAAALVHVIHGGFWREALSAELTAPI ARDLCTDGFLVANIEYRRVGGGGGWPETFEDVKAAIAAVRQAEPDLVRSL AVGHSAGGHLSLLALAAGSADFAVALAPVSDVDRALRENLGDGAAAEFLG VAGSSPREVQTASPIGNLGHRRQHVLIHGLRDVNVPVEHSRHYVSAARAS GTPVDYFEFANLDHFDLIDPSSSAWYAAKQWIRYQLT
Infection caused by Mycobacterium abscessus strains is a growing cause of concern in both community-acquired and health care-associated diseases, as these organisms naturally display multiple drug resistances. We report an annotated draft genome sequence of M. abscessus strain V06705 obtained from a patient in France.
Mycobacterium abscessus is a rapid-growing species of nontuberculous mycobacteria that is frequently associated with opportunistic infections in humans. We report herein the draft genome sequence of M. abscessus strain M93.
Mycobacterium massiliense (Mycobacterium abscessus group) is an emerging pathogen causing pulmonary disease and skin and soft tissue infections. We report the genome sequence of the type strain CCUG 48898.
        
2 lessTitle: Complete Genome Sequence of Mycobacterium massiliense Clinical Strain Asan 50594, Belonging to the Type II Genotype Kim BJ, Kim BR, Hong SH, Seok SH, Kook YH Ref: Genome Announc, 1:, 2013 : PubMed
We report the complete genome sequence of the Mycobacterium massiliense clinical strain Asan 50594, which was grouped into the M. massiliense type II genotype, isolated from a Korean patient. This genome sequence will serve as a valuable reference for understanding the disparity in virulence and epidemiological traits between strains belonging to the Mycobacterium abscessus complex.
Infection caused by Mycobacterium abscessus strains is a growing cause of concern in both community-acquired and health care-associated diseases, as these organisms naturally display multiple drug resistances. We report an annotated draft genome sequence of M. abscessus strain V06705 obtained from a patient in France.
        
Title: Whole-genome sequence of the emerging pathogen Mycobacterium abscessus strain 47J26 Chan J, Halachev M, Yates E, Smith G, Pallen M Ref: Journal of Bacteriology, 194:549, 2012 : PubMed
Mycobacterium abscessus is a rapidly growing environmental mycobacterium commonly found in soil and water which is often also associated with infections in humans, particularly of the lung. We report herein the draft genome sequence of M. abscessus strain 47J26.
Mycobacterium abscessus is a rapid-growing species of nontuberculous mycobacteria that is frequently associated with opportunistic infections in humans. We report herein the draft genome sequence of M. abscessus strain M93.
Mycobacterium massiliense (Mycobacterium abscessus group) is an emerging pathogen causing pulmonary disease and skin and soft tissue infections. We report the genome sequence of the type strain CCUG 48898.