Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: neovi-u6cqs5

Neovison vison (American mink) (Mustela vison) Cholinesterase

Relationship
Family|BCHE
Block| C
Position in NCBI Life Tree|Neovison vison
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Laurasiatheria: N E > Carnivora: N E > Caniformia: N E > Mustelidae: N E > Mustelinae: N E > Neovison: N E > Neovison vison: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : HAAF01000843
1 UniProt : U6CQS5
1 UniProt : U6CQS5
1 Interpro : U6CQS5
1 Pfam : U6CQS5
1 PIRSF : U6CQS5
1 SUPERFAM : U6CQS5
Sequence
Graphical view for this peptide sequence: neovi-u6cqs5
Colored MSA for BCHE (raw)
MQSKCTIISIRFLLRFLLFWVLIGKSRTEEDIIITTKNGKVRGINLPVLG
GTVTAFLGIPYAQPPLGRLRFKKPQFLTKWSDTWNATKYANSCYQNTDQS
FPGFPGSEMWNPNTDLSEDCLYLNVWVPTPKPKNATVMIWIYGGGFQTGT
SSLPVYDGKFLAWVERVIVVSMNYRVGALGFLALPGNPEVPGNMGLFDQQ
LALQWVQKNIAAFGGNPKSVTLFGESAGAGSVGLHLLSPRSQPLFTRAIL
QSGSSNAPWAVMSPDEARNRTLTLAKYIGCSKENETEIIKCLRNKDPQEV
LLNEVLVVPSDPLLSVNFGPIVDGDFLTDMPDTLLQLGQFKKAQILVGVN
KNEGTAFLVYRAPGFSKDNNSIITRKDFQEGLKMYFPGVSEFGRESILFY
YVDLLDDQRAEKYRDALDDVLGDYNIICPALEFTKKFSELGNNAFFYYFE
HRSSQLPWPEWMGVMHGYEIEFVFGLPLERRANYTKAEEILSRSIMKYWA
NFAKYGNPDGTQNNSTRWPAFKNTDQKYLTLNTESPRVYTKLRAQQCRFW
TLYFPKVLEMTGNIDEAEREWRAGFYRWNNYMMDWKNQFNDYTSKKESCA
GL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQSKCTIISIRFLLRFLLFWVLIGKSRTEEDIIITTKNGKVRGINLPVLG
GTVTAFLGIPYAQPPLGRLRFKKPQFLTKWSDTWNATKYANSCYQNTDQS
FPGFPGSEMWNPNTDLSEDCLYLNVWVPTPKPKNATVMIWIYGGGFQTGT
SSLPVYDGKFLAWVERVIVVSMNYRVGALGFLALPGNPEVPGNMGLFDQQ
LALQWVQKNIAAFGGNPKSVTLFGESAGAGSVGLHLLSPRSQPLFTRAIL
QSGSSNAPWAVMSPDEARNRTLTLAKYIGCSKENETEIIKCLRNKDPQEV
LLNEVLVVPSDPLLSVNFGPIVDGDFLTDMPDTLLQLGQFKKAQILVGVN
KNEGTAFLVYRAPGFSKDNNSIITRKDFQEGLKMYFPGVSEFGRESILFY
YVDLLDDQRAEKYRDALDDVLGDYNIICPALEFTKKFSELGNNAFFYYFE
HRSSQLPWPEWMGVMHGYEIEFVFGLPLERRANYTKAEEILSRSIMKYWA
NFAKYGNPDGTQNNSTRWPAFKNTDQKYLTLNTESPRVYTKLRAQQCRFW
TLYFPKVLEMTGNIDEAEREWRAGFYRWNNYMMDWKNQFNDYTSKKESCA
GL



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer