Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: nillu-ACHE1

Nilaparvata lugens (Brown planthopper) ace gene for acetylcholinesterase 1 precursor

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Nilaparvata lugens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Paraneoptera: N E > Hemiptera: N E > Auchenorrhyncha: N E > Fulgoromorpha: N E > Fulgoroidea: N E > Delphacidae: N E > Delphacinae: N E > Nilaparvata: N E > Nilaparvata lugens: N E


Molecular evidence
Database
7 mutations: Table (e.g. : F/Y330S, F331C/I332L, F331C ... more)
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 1 more: HQ605041, JQ027700, JQ585718
3 UniProt : G9BJC1, H9BIC5, J9R6H9
1 Ncbi-pid : 347343788
3 UniProt : G9BJC1, H9BIC5, J9R6H9
3 Interpro : G9BJC1, H9BIC5, J9R6H9
3 Prodom : G9BJC1, H9BIC5, J9R6H9
3 Pfam : G9BJC1, H9BIC5, J9R6H9
3 PIRSF : G9BJC1, H9BIC5, J9R6H9
3 SUPERFAM : G9BJC1, H9BIC5, J9R6H9
Sequence
Graphical view for this peptide sequence: nillu-ACHE1
Colored MSA for ACHE (raw)
MVVHTTKGRVRGVTLTASTGKQVDAWLGIPYAQKPIGPLRFRHPRPPDRW
DHGHDSHILNTTQLPNSCVQIIDTLFGDFPGSTMWNPNTPVSEDCLYMNV
VVPRPRPKQAAVMVWIFGGGFYSGTSTLDVYDHRTLVAEENVILVSMQYR
VASLGFLYFDTAEVPGNAGLFDQMMALQWVHDNIAAFGGNPRNVTLFGES
AGAVSVSLHLLSPLSRNLFSQAIMQSGSPTAPWAIISRDESILRGLRLAE
AMGCPHNRSEIAEATECLRRMNASDLVENEWGTLGICEFPFVPIVDGTFL
DDHPHRSLATKNFKKTNILMGSNTEEGYYFIFYHLTELFRNEENVYVNRD
EFLQAVRELNPYVNNVARQAIVFEYTDWLNPDDPIRNRDALDKMVGDYQF
TCNVNELAHRYADTGNNVYMYLFKHRSLSNPWPSWTGVMHGDEISYVFGE
PLDPNKSFQPAEIELSRRMMRYWANFAKTGNPSVSEDGTWTATYWPVHTA
YGREFLTLDVNSTATGRGPRLKQCAFWKKYLPQLLSSTSPPQPSPPPPAK
DICASSATLQSPGSATLLLLLATLCPLLATLWPLLATLWSSLATLSSTSL
HASSWPLLASSSPILATLWPLHATLWPLPASLWPLHATLWPSLATTLVAT
HHLPHRSTMPSIY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVVHTTKGRVRGVTLTASTGKQVDAWLGIPYAQKPIGPLRFRHPRPPDRW
DHGHDSHILNTTQLPNSCVQIIDTLFGDFPGSTMWNPNTPVSEDCLYMNV
VVPRPRPKQAAVMVWIFGGGFYSGTSTLDVYDHRTLVAEENVILVSMQYR
VASLGFLYFDTAEVPGNAGLFDQMMALQWVHDNIAAFGGNPRNVTLFGES
AGAVSVSLHLLSPLSRNLFSQAIMQSGSPTAPWAIISRDESILRGLRLAE
AMGCPHNRSEIAEATECLRRMNASDLVENEWGTLGICEFPFVPIVDGTFL
DDHPHRSLATKNFKKTNILMGSNTEEGYYFIFYHLTELFRNEENVYVNRD
EFLQAVRELNPYVNNVARQAIVFEYTDWLNPDDPIRNRDALDKMVGDYQF
TCNVNELAHRYADTGNNVYMYLFKHRSLSNPWPSWTGVMHGDEISYVFGE
PLDPNKSFQPAEIELSRRMMRYWANFAKTGNPSVSEDGTWTATYWPVHTA
YGREFLTLDVNSTATGRGPRLKQCAFWKKYLPQLLSSTSPPQPSPPPPAK
DICASSATLQSPGSATLLLLLATLCPLLATLWPLLATLWSSLATLSSTSL
HASSWPLLASSSPILATLWPLHATLWPLPASLWPLHATLWPSLATTLVAT
HHLPHRSTMPSIY


References
    Title: Cloning of the acetylcholinesterase 1 gene and identification of point mutations putatively associated with carbofuran resistance in Nilaparvata lugens
    Kwon DH, Cha DJ, Kim YH, Lee SW, Lee SH
    Ref: Pesticide Biochemistry and Physiology, 103:94, 2012 : PubMed

            

    Title: Molecular characterization of two acetylcholinesterase genes from the brown planthopper, Nilaparvata lugens (Hemiptera: Delphacidae)
    Li BL, Chen W, Liu L, Zhang XC, Bao YY, Cheng JA, Zhu ZR, Zhang CX
    Ref: Pesticide Biochemistry and Physiology, 102:198, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer