Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: penci-MLCF

Penicillium citrinum oxidoreductase

Relationship
Family|FSH1
Block| X
Position in NCBI Life Tree|Penicillium citrinum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Fungi: N E > Dikarya: N E > Ascomycota: N E > saccharomyceta: N E > Pezizomycotina: N E > leotiomyceta: N E > Eurotiomycetes: N E > Eurotiomycetidae: N E > Eurotiales: N E > Aspergillaceae: N E > Penicillium: N E > Penicillium citrinum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AB072893
1 UniProt : Q8J0F8
1 Interpro : Q8J0F8
1 Prodom : Q8J0F8
1 Pfam : Q8J0F8
1 PIRSF : Q8J0F8
1 SUPERFAM : Q8J0F8
Sequence
Graphical view for this peptide sequence: penci-MLCF
Colored MSA for FSH1 (raw)
MSPARITDFSPGKPRKALLCIHGAGCSAAIFRVQISKLRVALKNEFEFVY
ATAPFSSSPGPGVLPVFQGMGPYYTWFQKHHDAVTNTTTPTVGDRVAAVI
GPVQKTVQDWSITNPQAPIVGIVAFSEGALVATLLLHQQQMGKLPWFPKM
SIAVLICCFYSDEARDYMRAEAQDDDDKLIINVPTLHLHGRQDFALQGSR
QMVETHYLPQNADVLEFQGKHNFPNRPSDVQETVKRFQQLYQKVKMSGSF
V
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSPARITDFSPGKPRKALLCIHGAGCSAAIFRVQISKLRVALKNEFEFVY
ATAPFSSSPGPGVLPVFQGMGPYYTWFQKHHDAVTNTTTPTVGDRVAAVI
GPVQKTVQDWSITNPQAPIVGIVAFSEGALVATLLLHQQQMGKLPWFPKM
SIAVLICCFYSDEARDYMRAEAQDDDDKLIINVPTLHLHGRQDFALQGSR
QMVETHYLPQNADVLEFQGKHNFPNRPSDVQETVKRFQQLYQKVKMSGSF
V


References
    Title: Molecular cloning and characterization of an ML-236B (compactin) biosynthetic gene cluster in Penicillium citrinum
    Abe Y, Suzuki T, Ono C, Iwamoto K, Hosobuchi M, Yoshikawa H
    Ref: Mol Genet Genomics, 267:636, 2002 : PubMed

            

    Title: Effect of increased dosage of the ML-236B (compactin) biosynthetic gene cluster on ML-236B production in Penicillium citrinum
    Abe Y, Suzuki T, Mizuno T, Ono C, Iwamoto K, Hosobuchi M, Yoshikawa H
    Ref: Mol Genet Genomics, 268:130, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer