Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pluxy-ACHE1

Plutella xylostella (Diamondback moth) (Plutella maculipennis) ace1-type acetylcholinesterase (ace1) mRNA

Comment
Q1X860 strain PR By Lee D.-W., Lee S.H., Boo K.S. some differences in sequence I1VRJ6 resistant I1VRJ7 sensitive


Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Plutella xylostella
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Amphiesmenoptera: N E > Lepidoptera: N E > Glossata: N E > Neolepidoptera: N E > Heteroneura: N E > Ditrysia: N E > Yponomeutoidea: N E > Plutellidae: N E > Plutella: N E > Plutella xylostella: N E


Molecular evidence
Database
5 mutations: Table (e.g. : A201S, A441G, D131G ... more)
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 2 more: AY773014, AY970293, JQ085428
>3 UniProt links 2 more: Q5S579, Q1X860, I1VRJ6
1 Ncbi-nid : 55793688
1 Ncbi-pid : 55793689
>3 UniProt links 2 more: Q5S579, Q1X860, I1VRJ6
>3 Interpro links 2 more: Q5S579, Q1X860, I1VRJ6
>3 Prodom links 2 more: Q5S579, Q1X860, I1VRJ6
>3 Pfam links 2 more: Q5S579, Q1X860, I1VRJ6
>3 PIRSF links 2 more: Q5S579, Q1X860, I1VRJ6
>3 SUPERFAM links 2 more: Q5S579, Q1X860, I1VRJ6
Sequence
Graphical view for this peptide sequence: pluxy-ACHE1
Colored MSA for ACHE (raw)
MRALLAVLCAAAAAAGASAGAHEHRARHHAPEHAYPPPPYRGHGEAVRYN
PELDTILPRLDHETSSRRAKYADKHDDYRARERLDAPQADQPALGPDDDD
PLVVRTRKGRVRGITLTAATGKKVDAWFGIPYAQKPIGDLRFRHPRPVEN
WGDEILNATTLPHSCVQIIDTVFGDFPGAMMWNPNTDMQEDCLYINIVTP
RPRPKNAAVMLWVFGGGFYSGTATLDVYDPKILVSEEKIVYVSMQYRVAS
LGFLFFDTPDVPGNAGLFDQLMALQWVKDNIQYFGGNPHNVTLFGESSGA
VSVSLHLLSPLSRNMFSQAIMQSAAASAPWAIISREESVIRGIRLAEAVH
CPHSKTDMGPMIECLRKKSADELVNNEWGTLGICEFPFVPIIDGSFLDEM
PIRSLAHQNFKKTNILMGSNTEEGYYFILYYLTELFPKEENVGISREQYL
QAVRELNPYVNDVARQAIVFEYTDWLNPDDPIRNRNALDKMVGDYHFTCG
VNEFAHRYAETGNNVYTYYYKHRSKNNPWPSWTGVMHGDEINYVFGEPSN
PGKNYSPEEVEFSKTIMRYWANFARTGNPSQSPNGELTKVHWPVHTAFGR
EHLSLSANSSGTVDHGLRVKQCAFWQKYLPQLIAATSKPEPPKNCTSSAE
APRASYHVLGLAVVAAVSFSQKTIVKLII
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRALLAVLCAAAAAAGASAGAHEHRARHHAPEHAYPPPPYRGHGEAVRYN
PELDTILPRLDHETSSRRAKYADKHDDYRARERLDAPQADQPALGPDDDD
PLVVRTRKGRVRGITLTAATGKKVDAWFGIPYAQKPIGDLRFRHPRPVEN
WGDEILNATTLPHSCVQIIDTVFGDFPGAMMWNPNTDMQEDCLYINIVTP
RPRPKNAAVMLWVFGGGFYSGTATLDVYDPKILVSEEKIVYVSMQYRVAS
LGFLFFDTPDVPGNAGLFDQLMALQWVKDNIQYFGGNPHNVTLFGESSGA
VSVSLHLLSPLSRNMFSQAIMQSAAASAPWAIISREESVIRGIRLAEAVH
CPHSKTDMGPMIECLRKKSADELVNNEWGTLGICEFPFVPIIDGSFLDEM
PIRSLAHQNFKKTNILMGSNTEEGYYFILYYLTELFPKEENVGISREQYL
QAVRELNPYVNDVARQAIVFEYTDWLNPDDPIRNRNALDKMVGDYHFTCG
VNEFAHRYAETGNNVYTYYYKHRSKNNPWPSWTGVMHGDEINYVFGEPSN
PGKNYSPEEVEFSKTIMRYWANFARTGNPSQSPNGELTKVHWPVHTAFGR
EHLSLSANSSGTVDHGLRVKQCAFWQKYLPQLIAATSKPEPPKNCTSSAE
APRASYHVLGLAVVAAVSFSQKTIVKLII


References
    Title: Trade-off between thermal tolerance and insecticide resistance in Plutella xylostella
    Zhang LJ, Wu ZL, Wang KF, Liu Q, Zhuang HM, Wu G
    Ref: Ecol Evol, 5:515, 2015 : PubMed

            

    Title: Mutations of acetylcholinesterase1 contribute to prothiofos-resistance in Plutella xylostella (L.)
    Lee DW, Choi JY, Kim WT, Je YH, Song JT, Chung BK, Boo KS, Koh YH
    Ref: Biochemical & Biophysical Research Communications, 353:591, 2007 : PubMed

            

    Title: Identification and characterization of ace1-type acetylcholinesterase likely associated with organophosphate resistance in Plutella xylostella
    Baek JH, Kim JI, Lee DW, Chung BK, Miyata T, Lee SH
    Ref: Pesticide Biochemistry and Physiology, 81:164, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer