Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: psefl-q7wzt7

Pseudomonas fluorescens lipase lipJ02

Comment
Q64H38_9PSED from uncultured Pseudomonas few aa diff


Relationship
Family|Bacterial_lip_FamI.3
Block| L
Position in NCBI Life Tree|Pseudomonas fluorescens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Pseudomonadales: N E > Pseudomonadaceae: N E > Pseudomonas: N E > Pseudomonas fluorescens group: N E > Pseudomonas fluorescens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AY304500, AY673674
2 UniProt : Q7WZT7, Q64H38
2 UniProt : Q7WZT7, Q64H38
2 Interpro : Q7WZT7, Q64H38
2 Pfam : Q7WZT7, Q64H38
2 PIRSF : Q7WZT7, Q64H38
2 SUPERFAM : Q7WZT7, Q64H38
Sequence
Graphical view for this peptide sequence: psefl-q7wzt7
Colored MSA for Bacterial_lip_FamI.3 (raw)
MGVFDYKNLGAEGSKALFADAMAITLYTYHNLDNGFAVGYQHNGLGFGLP
ATLVGALLGSSDSQGVIPGIPWNPDSEKAALEAVQQAGWTPISASALGYT
GKVDARGTFFGEKPGYTTAQVEVLGKYDDAGKLLEIGIGFRGTSGPRESL
ISDSIGDLVSDLLAALGPKDYAKNYAGEAFGGLLKNIADYASAHGLSGHD
VVVSGHSLGGLAVNSMADLSNGKWAGFFKDANYVAYASPTQSSGDKVLNV
GYENDPVFRALDGSSVNWSSLGVHDKPHESTTDNIVSFNDHYASTLWNVL
PFSITNLPTWISHLPTGYGDGMTRVLASGFYEVMTRDSTIIVANLSDPAR
ANTWVQDLNRNAEPHKGDTFIIGSAGNDLIQGGKGADFIEAGKGNDTIRD
SSGHNTFLFSGQFGQDRIIGYQPTDKLVFTDVQSSGDYRDHAKVVGGDTV
ISFGGDSVTLVGVVGLSGEGIVIS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGVFDYKNLGAEGSKALFADAMAITLYTYHNLDNGFAVGYQHNGLGFGLP
ATLVGALLGSSDSQGVIPGIPWNPDSEKAALEAVQQAGWTPISASALGYT
GKVDARGTFFGEKPGYTTAQVEVLGKYDDAGKLLEIGIGFRGTSGPRESL
ISDSIGDLVSDLLAALGPKDYAKNYAGEAFGGLLKNIADYASAHGLSGHD
VVVSGHSLGGLAVNSMADLSNGKWAGFFKDANYVAYASPTQSSGDKVLNV
GYENDPVFRALDGSSVNWSSLGVHDKPHESTTDNIVSFNDHYASTLWNVL
PFSITNLPTWISHLPTGYGDGMTRVLASGFYEVMTRDSTIIVANLSDPAR
ANTWVQDLNRNAEPHKGDTFIIGSAGNDLIQGGKGADFIEAGKGNDTIRD
SSGHNTFLFSGQFGQDRIIGYQPTDKLVFTDVQSSGDYRDHAKVVGGDTV
ISFGGDSVTLVGVVGLSGEGIVIS


Reference
    Title: Characterization of two novel lipase genes isolated directly from environmental sample
    Jiang Z, Wang H, Ma Y, Wei D
    Ref: Applied Microbiology & Biotechnology, 70:327, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer