Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pyrca-PCEST

Pyrobaculum calidifontis esterase (EC 3.1.1.1) PCEST Pc-est PestE

Comment
Extremely stable and versatile carboxylesterase. promiscuous acyltransferase


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Pyrobaculum calidifontis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > TACK group: N E > Crenarchaeota: N E > Thermoprotei: N E > Thermoproteales: N E > Thermoproteaceae: N E > Pyrobaculum: N E > Pyrobaculum calidifontis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 2YH2, 3ZWQ
No kinetic





1 substrate:
Menthol
No inhibitor
1 Genbank : AB078331
2 Structure : 2YH2, 3ZWQ
1 UniProt : Q8NKS0
1 Interpro : Q8NKS0
1 Pfam : Q8NKS0
1 PIRSF : Q8NKS0
1 SUPERFAM : Q8NKS0
Sequence
Graphical view for this peptide sequence: pyrca-PCEST
Colored MSA for Hormone-sensitive_lipase_like (raw)
MPLSPILRQILQQLAAQLQFRPDMDVKTVREQFEKSSLILVKMANEPIHR
VEDITIPGRGGPIRARVYRPRDGERLPAVVYYHGGGFVLGSVETHDHVCR
RLANLSGAVVVSVDYRLAPEHKFPAAVEDAYDAAKWVADNYDKLGVDNGK
IAVAGDSAGGNLAAVTAIMARDRGESFVKYQVLIYPAVNLTGSPTVSRVE
YSGPEYVILTADLMAWFGRQYFSKPQDALSPYASPIFADLSNLPPALVIT
AEYDPLRDEGELYAHLLKTRGVRAVAVRYNGVIHGFVNFYPILEEGREAV
SQIAASIKSMAVA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPLSPILRQILQQLAAQLQFRPDMDVKTVREQFEKSSLILVKMANEPIHR
VEDITIPGRGGPIRARVYRPRDGERLPAVVYYHGGGFVLGSVETHDHVCR
RLANLSGAVVVSVDYRLAPEHKFPAAVEDAYDAAKWVADNYDKLGVDNGK
IAVAGDSAGGNLAAVTAIMARDRGESFVKYQVLIYPAVNLTGSPTVSRVE
YSGPEYVILTADLMAWFGRQYFSKPQDALSPYASPIFADLSNLPPALVIT
AEYDPLRDEGELYAHLLKTRGVRAVAVRYNGVIHGFVNFYPILEEGREAV
SQIAASIKSMAVA


References
2 more
    Title: Chemoenzymatic Cascade Reaction for the Valorization of the Lignin Depolymerization Product G-C2-Dioxolane Phenol
    Terholsen H, Meyer JRH, Zhang Z, Deuss PJ, Bornscheuer UT
    Ref: ChemSusChem, 16:e202300168, 2023 : PubMed

            

    Title: Recovery of hydroxytyrosol from olive mill wastewater using the promiscuous hydrolase/acyltransferase PestE
    Terholsen H, Kaur J, Kaloudis N, Staudt A, Muller H, Pavlidis IV, Bornscheuer U
    Ref: Chembiochem, 23:e202200254, 2022 : PubMed

            

    Title: Rational Design for Enhanced Acyltransferase Activity in Water Catalyzed by the Pyrobaculum calidifontis VA1 Esterase
    Staudt A, Terholsen H, Kaur J, Muller H, Godehard SP, Itabaiana I, Jr., Leal ICR, Bornscheuer UT
    Ref: Microorganisms, 9:1790, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer