Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: pyrca-PCEST

Pyrobaculum calidifontis esterase (EC 3.1.1.1) PCEST Pc-est PestE

Comment
Extremely stable and versatile carboxylesterase. promiscuous acyltransferase


Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Pyrobaculum calidifontis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > TACK group: N E > Crenarchaeota: N E > Thermoprotei: N E > Thermoproteales: N E > Thermoproteaceae: N E > Pyrobaculum: N E > Pyrobaculum calidifontis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 2YH2, 3ZWQ
No kinetic





No Substrate
No inhibitor
1 Genbank : AB078331
2 Structure : 2YH2, 3ZWQ
1 UniProt : Q8NKS0
1 Interpro : Q8NKS0
1 Prodom : Q8NKS0
1 Pfam : Q8NKS0
1 PIRSF : Q8NKS0
1 SUPERFAM : Q8NKS0
Sequence
Graphical view for this peptide sequence: pyrca-PCEST
Colored MSA for Hormone-sensitive_lipase_like (raw)
MPLSPILRQILQQLAAQLQFRPDMDVKTVREQFEKSSLILVKMANEPIHR
VEDITIPGRGGPIRARVYRPRDGERLPAVVYYHGGGFVLGSVETHDHVCR
RLANLSGAVVVSVDYRLAPEHKFPAAVEDAYDAAKWVADNYDKLGVDNGK
IAVAGDSAGGNLAAVTAIMARDRGESFVKYQVLIYPAVNLTGSPTVSRVE
YSGPEYVILTADLMAWFGRQYFSKPQDALSPYASPIFADLSNLPPALVIT
AEYDPLRDEGELYAHLLKTRGVRAVAVRYNGVIHGFVNFYPILEEGREAV
SQIAASIKSMAVA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPLSPILRQILQQLAAQLQFRPDMDVKTVREQFEKSSLILVKMANEPIHR
VEDITIPGRGGPIRARVYRPRDGERLPAVVYYHGGGFVLGSVETHDHVCR
RLANLSGAVVVSVDYRLAPEHKFPAAVEDAYDAAKWVADNYDKLGVDNGK
IAVAGDSAGGNLAAVTAIMARDRGESFVKYQVLIYPAVNLTGSPTVSRVE
YSGPEYVILTADLMAWFGRQYFSKPQDALSPYASPIFADLSNLPPALVIT
AEYDPLRDEGELYAHLLKTRGVRAVAVRYNGVIHGFVNFYPILEEGREAV
SQIAASIKSMAVA


References
    Title: Recovery of hydroxytyrosol from olive mill wastewater using the promiscuous hydrolase/acyltransferase PestE
    Terholsen H, Kaur J, Kaloudis N, Staudt A, Muller H, Pavlidis IV, Bornscheuer U
    Ref: Chembiochem, :, 2022 : PubMed

            

    Title: The crystal structure of an esterase from the hyperthermophilic microorganism Pyrobaculum calidifontis VA1 explains its enantioselectivity
    Palm GJ, Fernandez-Alvaro E, Bogdanovic X, Bartsch S, Sczodrok J, Singh RK, Bottcher D, Atomi H, Bornscheuer UT, Hinrichs W
    Ref: Applied Microbiology & Biotechnology, 91:1061, 2011 : PubMed

            

    Title: Extremely stable and versatile carboxylesterase from a hyperthermophilic archaeon
    Hotta Y, Ezaki S, Atomi H, Imanaka T
    Ref: Applied Environmental Microbiology, 68:3925, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer