Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: ratno-aryla

Rattus norvegicus (Rat) Arylacetamide deacetylase gene (aadac)

Comment
Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly. Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity


Relationship
Family|Arylacetamide_deacetylase
Block| H
Position in NCBI Life Tree|Rattus norvegicus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Deuterostomia: N E > Chordata: N E > Craniata: N E > Vertebrata: N E > Gnathostomata: N E > Teleostomi: N E > Euteleostomi: N E > Sarcopterygii: N E > Dipnotetrapodomorpha: N E > Tetrapoda: N E > Amniota: N E > Mammalia: N E > Theria: N E > Eutheria: N E > Boreoeutheria: N E > Euarchontoglires: N E > Glires: N E > Rodentia: N E > Myomorpha: N E > Muroidea: N E > Muridae: N E > Murinae: N E > Rattus: N E > Rattus norvegicus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AF264017, AF182426
2 UniProt : Q9QZH8, Q5I0N0
1 Ncbi-nid : 8347732
1 Ncbi-pid : 8347733
2 UniProt : Q9QZH8, Q5I0N0
2 Interpro : Q9QZH8, Q5I0N0
2 Prodom : Q9QZH8, Q5I0N0
2 Pfam : Q9QZH8, Q5I0N0
2 PIRSF : Q9QZH8, Q5I0N0
2 SUPERFAM : Q9QZH8, Q5I0N0
Sequence
Graphical view for this peptide sequence: ratno-aryla
Colored MSA for Arylacetamide_deacetylase (raw)
MGRTIFLLISVVLVAYYIYIPLPDDIEEPWKIILGNTLLKLGGDLASFGE
LLGLNHFMDTVQLFMRFQVVPPTSDENVTVMETDFNSVPVRIYIPKRKST
TLRRGLFFIHGGGWCLGSAAYFMYDTLSRRTAHRLDAVVVSTDYGLAPKY
HFPKQFEDVYHSLRWFLQEDILEKYGVDPRRVGVSGDSAGGNLTAAVTQQ
ILQDPDVKIKLKVQALIYPALQALDMNVPSQQENSQYPLLTRSLLIRFWS
EYFTTDRDLEKAMLLNQHVPVEFSHLLQFVNWSSLLPQRYKKGYFYKTPT
PGSLELAQKYPGFTDVKACPLLANDSILHHLPMTYIITCQYDVLRDDGLM
YVKRLQNTGVHVTHHHIEDGFHGALTLPGLKITYRMQNQYLNWLHKNL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGRTIFLLISVVLVAYYIYIPLPDDIEEPWKIILGNTLLKLGGDLASFGE
LLGLNHFMDTVQLFMRFQVVPPTSDENVTVMETDFNSVPVRIYIPKRKST
TLRRGLFFIHGGGWCLGSAAYFMYDTLSRRTAHRLDAVVVSTDYGLAPKY
HFPKQFEDVYHSLRWFLQEDILEKYGVDPRRVGVSGDSAGGNLTAAVTQQ
ILQDPDVKIKLKVQALIYPALQALDMNVPSQQENSQYPLLTRSLLIRFWS
EYFTTDRDLEKAMLLNQHVPVEFSHLLQFVNWSSLLPQRYKKGYFYKTPT
PGSLELAQKYPGFTDVKACPLLANDSILHHLPMTYIITCQYDVLRDDGLM
YVKRLQNTGVHVTHHHIEDGFHGALTLPGLKITYRMQNQYLNWLHKNL


References
    Title: Species differences in tissue distribution and enzyme activities of arylacetamide deacetylase in human, rat, and mouse
    Kobayashi Y, Fukami T, Nakajima A, Watanabe A, Nakajima M, Yokoi T
    Ref: Drug Metabolism & Disposition: The Biological Fate of Chemicals, 40:671, 2012 : PubMed

            

    Title: Characterization of the rodent genes for arylacetamide deacetylase, a putative microsomal lipase, and evidence for transcriptional regulation
    Trickett JI, Patel DD, Knight BL, Saggerson ED, Gibbons GF, Pease RJ
    Ref: Journal of Biological Chemistry, 276:39522, 2001 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer