Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhoca-PHAC

Rhodobacter capsulatus (Rhodopseudomonas capsulata) pha-synthase

Comment
Other strains: Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)


Relationship
Family|PHA_synth_I
Block| X
Position in NCBI Life Tree|Rhodobacter capsulatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhodobacterales: N E > Rhodobacteraceae: N E > Rhodobacter: N E > Rhodobacter capsulatus: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AJ315564
2 UniProt : Q8VMB1, D5APD9
2 UniProt : Q8VMB1, D5APD9
2 Interpro : Q8VMB1, D5APD9
2 Pfam : Q8VMB1, D5APD9
2 PIRSF : Q8VMB1, D5APD9
2 SUPERFAM : Q8VMB1, D5APD9
Sequence
Graphical view for this peptide sequence: rhoca-PHAC
Colored MSA for PHA_synth_I (raw)
MRDNLARIETLTQRMVEAFAQKRAPNPALEGPGLDLYVASSSALLREMTA
NPAKIFEAQVSYWAQAMTHYIDATHAFAQGTFKPPADPGPKDRRFSNPLW
DSHPYFNFIKQQYLIASSSIEEALSKIEGLDPVDRRRLEMFSKQIIDMMA
PTNFLATNPDALEKAVATEGESLVRGLENLVRDIEANRGDLVITLSDKNA
FSVGHNIGTAKGQVVWRNRLMEIIQYEPTTPEVHKTPLIIFPPWINKFYI
LDLKPQNSLIRWIVDQGFTLFVVSWKNPDRSYADVGMEDYVRDGYLAAIE
EVKAITGEKQVNAVGYCIAGTTLSLVLSLLEKRKDKSIKSATFFTTLTDF
SDQGEFTPFLQDDFVDGIERQVRLDGVLSSYYMTRTFSYLRANDLIYQPA
IRSYMMGESPPAFDLLYWNGDSTNLPGKMAMEYLRGLCQADAFTTEGFEL
MGERLHVSGVKVPLCAIACETDHIAPWIVSFNGVAQMGSTDKTFILTESG
HIAGIVNPPSKDKYGHYTSAAPIADHQVWKAQATYTKGSWWPRWGEWLAG
HSGKKIPARAPGDATHPPLAPAPGTYVSEVVVL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRDNLARIETLTQRMVEAFAQKRAPNPALEGPGLDLYVASSSALLREMTA
NPAKIFEAQVSYWAQAMTHYIDATHAFAQGTFKPPADPGPKDRRFSNPLW
DSHPYFNFIKQQYLIASSSIEEALSKIEGLDPVDRRRLEMFSKQIIDMMA
PTNFLATNPDALEKAVATEGESLVRGLENLVRDIEANRGDLVITLSDKNA
FSVGHNIGTAKGQVVWRNRLMEIIQYEPTTPEVHKTPLIIFPPWINKFYI
LDLKPQNSLIRWIVDQGFTLFVVSWKNPDRSYADVGMEDYVRDGYLAAIE
EVKAITGEKQVNAVGYCIAGTTLSLVLSLLEKRKDKSIKSATFFTTLTDF
SDQGEFTPFLQDDFVDGIERQVRLDGVLSSYYMTRTFSYLRANDLIYQPA
IRSYMMGESPPAFDLLYWNGDSTNLPGKMAMEYLRGLCQADAFTTEGFEL
MGERLHVSGVKVPLCAIACETDHIAPWIVSFNGVAQMGSTDKTFILTESG
HIAGIVNPPSKDKYGHYTSAAPIADHQVWKAQATYTKGSWWPRWGEWLAG
HSGKKIPARAPGDATHPPLAPAPGTYVSEVVVL


Reference
    Title: Complete genome sequence of the photosynthetic purple nonsulfur bacterium Rhodobacter capsulatus SB 1003
    Strnad H, Lapidus A, Paces J, Ulbrich P, Vlcek C, Paces V, Haselkorn R
    Ref: Journal of Bacteriology, 192:3545, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer