Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhocb-d5akf6

Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) Putative uncharacterized protein

Relationship
Family|Duf_900
Block| X
Position in NCBI Life Tree|Rhodobacter capsulatus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhodobacterales: N E > Rhodobacteraceae: N E > Rhodobacter: N E > Rhodobacter capsulatus: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP001312
1 UniProt : D5AKF6
1 UniProt : D5AKF6
1 Interpro : D5AKF6
1 Pfam : D5AKF6
1 PIRSF : D5AKF6
1 SUPERFAM : D5AKF6
Sequence
Graphical view for this peptide sequence: rhocb-d5akf6
Colored MSA for Duf_900 (raw)
MQSRLLVVAAFLALISCAPRGEIAYTPEPSADIRPVFVGSTRGLDPETGA
EFGHSRSETLQRARFDVSVPPDRGTGQLSYPLQGRKIDPRKDFVLAGSQK
YPGAEAFQAALRQSLKKSGGEAVVFVHGFNNTFAEGLYRLAQMGVDFDLP
KTLVYYAWPSRGQLLGYAYDRDSAIFARDGLRETLRELHRAGAKRILLVG
HSMGSSVTMETLRDMALSGERSTLAELEGVILISPDIDVDMFREQARTIG
QLPQPFVIFTSKKDKALLLSSKIAGEPDRLGTLQDLRRVADLKVTMIDTG
AFSTADGHFNVANNPALIRLLGQTGQVVKILEGDQTGKRNLAAGVVLSVQ
NATRIVLSPITALGGAN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQSRLLVVAAFLALISCAPRGEIAYTPEPSADIRPVFVGSTRGLDPETGA
EFGHSRSETLQRARFDVSVPPDRGTGQLSYPLQGRKIDPRKDFVLAGSQK
YPGAEAFQAALRQSLKKSGGEAVVFVHGFNNTFAEGLYRLAQMGVDFDLP
KTLVYYAWPSRGQLLGYAYDRDSAIFARDGLRETLRELHRAGAKRILLVG
HSMGSSVTMETLRDMALSGERSTLAELEGVILISPDIDVDMFREQARTIG
QLPQPFVIFTSKKDKALLLSSKIAGEPDRLGTLQDLRRVADLKVTMIDTG
AFSTADGHFNVANNPALIRLLGQTGQVVKILEGDQTGKRNLAAGVVLSVQ
NATRIVLSPITALGGAN


Reference
    Title: Complete genome sequence of the photosynthetic purple nonsulfur bacterium Rhodobacter capsulatus SB 1003
    Strnad H, Lapidus A, Paces J, Ulbrich P, Vlcek C, Paces V, Haselkorn R
    Ref: Journal of Bacteriology, 192:3545, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer