Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhoer-c3jfu1

Rhodococcus erythropolis; Rhodococcus sp.; Rhodococcus qingshengii, 3-oxoadipate enol-lactone hydrolase/4-carboxymuconolactone decarboxylase

Comment
Other strains: Rhodococcus erythropolis (SK121; PR4 / NBRC 100887 DN1, CCM2595); Rhodococcus sp. P27; Rhodococcus qingshengii BKS 20-40


Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|Rhodococcus erythropolis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Nocardiaceae: N E > Rhodococcus: N E > Rhodococcus erythropolis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 3 more: ACNO01000001, AP008957, AVCO01000053
>3 UniProt links 1 more: C3JFU1, C0ZS05, U0EA13
>3 UniProt links 1 more: C3JFU1, C0ZS05, U0EA13
>3 Interpro links 1 more: C3JFU1, C0ZS05, U0EA13
>3 Pfam links 1 more: C3JFU1, C0ZS05, U0EA13
>3 PIRSF links 1 more: C3JFU1, C0ZS05, U0EA13
>3 SUPERFAM links 1 more: C3JFU1, C0ZS05, U0EA13
Sequence
Graphical view for this peptide sequence: rhoer-c3jfu1
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MSVALNFQQTGNLDAPAVVLLGSLGSDLSMWQPQIHALSNRYRVIAVDHR
GHGKSPVPAGPYSIADLAGDVIALLDSLELESVHLVGLSLGGAVSQWIAA
HHPTRVETLTLMCTSSQFAPAQPWIDRARAVRADGIASIAAAVVGRWFTP
GLADNDPELVARHVAMVEATPDEGYAACCEALSTWDGRNDLARIVAPTLL
IAGEQDPATPPATLSAIADGIADAVLHVVDPGAHLANVEQAGRVTKLLAT
HI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSVALNFQQTGNLDAPAVVLLGSLGSDLSMWQPQIHALSNRYRVIAVDHR
GHGKSPVPAGPYSIADLAGDVIALLDSLELESVHLVGLSLGGAVSQWIAA
HHPTRVETLTLMCTSSQFAPAQPWIDRARAVRADGIASIAAAVVGRWFTP
GLADNDPELVARHVAMVEATPDEGYAACCEALSTWDGRNDLARIVAPTLL
IAGEQDPATPPATLSAIADGIADAVLHVVDPGAHLANVEQAGRVTKLLAT
HI


References
2 more
    Title: Whole-Genome Shotgun Sequencing of Rhodococcus erythropolis Strain P27, a Highly Radiation-Resistant Actinomycete from Antarctica
    Gouvea Taketani R, Domingues Zucchi T, Soares de Melo I, Mendes R
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Draft Genome Sequence of Rhodococcus erythropolis DN1, a Crude Oil Biodegrader
    Shevtsov A, Tarlykov P, Zholdybayeva E, Momynkulov D, Sarsenova A, Moldagulova N, Momynaliev K
    Ref: Genome Announc, 1:, 2013 : PubMed

            

    Title: Sequence analysis of three plasmids harboured in Rhodococcus erythropolis strain PR4
    Sekine M, Tanikawa S, Omata S, Saito M, Fujisawa T, Tsukatani N, Tajima T, Sekigawa T, Kosugi H and Harayama S <7 more author(s)>
    Ref: Environ Microbiol, 8:334, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer