Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: rhos4-q3j2v1

Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DS158) phospholipase/carboxylesterase

Relationship
Family|LYsophospholipase_carboxylesterase
Block| X
Position in NCBI Life Tree|Rhodobacter sphaeroides
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Rhodobacterales: N E > Rhodobacteraceae: N E > Rhodobacter: N E > Rhodobacter sphaeroides: N E


Molecular evidence
Database
No mutation
2 structures: 4FHZ, 4FTW
No kinetic





No Substrate
No inhibitor
1 Genbank : CP000143
1 UniProt : Q3J2V1
2 Structure : 4FTW, 4FHZ
1 UniProt : Q3J2V1
1 Interpro : Q3J2V1
1 Prodom : Q3J2V1
1 Pfam : Q3J2V1
1 PIRSF : Q3J2V1
1 SUPERFAM : Q3J2V1
Sequence
Graphical view for this peptide sequence: rhos4-q3j2v1
Colored MSA for LYsophospholipase_carboxylesterase (raw)
MTRKLTFGRRGAAPGEATSLVVFLHGYGADGADLLGLAEPLAPHLPGTAF
VAPDAPEPCRANGFGFQWFPIPWLDGSSETAAAEGMAAAARDLDAFLDER
LAEEGLPPEALALVGFSQGTMMALHVAPRRAEEIAGIVGFSGRLLAPERL
AEEARSKPPVLLVHGDADPVVPFADMSLAGEALAEAGFTTYGHVMKGTGH
GIAPDGLSVALAFLKERLPD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTRKLTFGRRGAAPGEATSLVVFLHGYGADGADLLGLAEPLAPHLPGTAF
VAPDAPEPCRANGFGFQWFPIPWLDGSSETAAAEGMAAAARDLDAFLDER
LAEEGLPPEALALVGFSQGTMMALHVAPRRAEEIAGIVGFSGRLLAPERL
AEEARSKPPVLLVHGDADPVVPFADMSLAGEALAEAGFTTYGHVMKGTGH
GIAPDGLSVALAFLKERLPD


Reference
    Title: Enhanced enantioselectivity of a carboxyl esterase from Rhodobacter sphaeroides by directed evolution
    Ma J, Wu L, Guo F, Gu J, Tang X, Jiang L, Liu J, Zhou J, Yu H
    Ref: Applied Microbiology & Biotechnology, 97:4897, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer