Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: serma-lipasA

Serratia marcescens LipA gene for lipase

Comment
the 2 sequences differ only 2aa (ES-2 lipase (esf) DQ841349 very close also)


Relationship
Family|Bacterial_lip_FamI.3
Block| L
Position in NCBI Life Tree|Serratia marcescens
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Enterobacterales: N E > Yersiniaceae: N E > Serratia: N E > Serratia marcescens: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 2QUA, 2QUB
No kinetic





3 substrates: Ethyl-Flurbiprofen, Ethyl-Zaltoprofen, Ketoprofen-Ethyl-Ester
No inhibitor
>3 Genbank links 1 more: D13253, U11258, DQ841349
>3 UniProt links 1 more: Q0MVP2, Q59933, Q09KJ5
1 Ncbi-nid : 216949
1 Ncbi-pid : 216950
2 Structure : 2QUA, 2QUB
>3 UniProt links 2 more: Q0MVP2, Q09KJ5, Q59933
>3 Interpro links 2 more: Q0MVP2, Q09KJ5, Q59933
>3 Prodom links 2 more: Q0MVP2, Q09KJ5, Q59933
>3 Pfam links 2 more: Q0MVP2, Q09KJ5, Q59933
>3 PIRSF links 2 more: Q0MVP2, Q09KJ5, Q59933
>3 SUPERFAM links 2 more: Q0MVP2, Q09KJ5, Q59933
Sequence
Graphical view for this peptide sequence: serma-lipasA
Colored MSA for Bacterial_lip_FamI.3 (raw)
SHMGIFSYKDLDENASKALFSDALAISTYAYHNIDNGFDEGYHQTGFGLG
LPLTLITALIGSTQSQGGLPGLPWNPDSEQAAQEAVNNAGWSVISATQLG
YAGKTDARGTYYGETAGYTTAQAEVLGKYDSEGNLTAIGISFRGTSGPRE
SLIGDTIGDVINDLLAGFGPKGYADGYTLKAFGNLLGDVAKFAQAHGLSG
EDVVVSGHSLGGLAVNSMAAQSDANWGGFYAQSNYVAFASPTQYEAGGKV
INIGYENDPVFRALDGTSLTLPSLGVHDAPHTSATNNIVNFNDHYASDAW
NLLPFSILNIPTWLSHLPFFYQDGLMRVLNSEFYSLTDKDSTIIVSNLSN
VTRGNTWVEDLNRNAETHSGPTFIIGSDGNDLIKGGKGNDYLEGRDGDDI
FRDAGGYNLIAGGKGHNIFDTQQALKNTEVAYDGNTLYLRDAKGGITLAD
DISTLRSKETSWLIFNKEVDHQVTAAGLKSDSGLKAYAAATGGDGDDVLQ
ARSHDAWLFGNAGNDTLIGHAGGNLTFVGGSGDDILKGVGNGNTFLFSGD
FGRDQLYGFNASDKLVFIGTEGASGNIRDYATQQNDDLVLAFGHSQVTLI
GVSLDHISTDQVVLA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

SHMGIFSYKDLDENASKALFSDALAISTYAYHNIDNGFDEGYHQTGFGLG
LPLTLITALIGSTQSQGGLPGLPWNPDSEQAAQEAVNNAGWSVISATQLG
YAGKTDARGTYYGETAGYTTAQAEVLGKYDSEGNLTAIGISFRGTSGPRE
SLIGDTIGDVINDLLAGFGPKGYADGYTLKAFGNLLGDVAKFAQAHGLSG
EDVVVSGHSLGGLAVNSMAAQSDANWGGFYAQSNYVAFASPTQYEAGGKV
INIGYENDPVFRALDGTSLTLPSLGVHDAPHTSATNNIVNFNDHYASDAW
NLLPFSILNIPTWLSHLPFFYQDGLMRVLNSEFYSLTDKDSTIIVSNLSN
VTRGNTWVEDLNRNAETHSGPTFIIGSDGNDLIKGGKGNDYLEGRDGDDI
FRDAGGYNLIAGGKGHNIFDTQQALKNTEVAYDGNTLYLRDAKGGITLAD
DISTLRSKETSWLIFNKEVDHQVTAAGLKSDSGLKAYAAATGGDGDDVLQ
ARSHDAWLFGNAGNDTLIGHAGGNLTFVGGSGDDILKGVGNGNTFLFSGD
FGRDQLYGFNASDKLVFIGTEGASGNIRDYATQQNDDLVLAFGHSQVTLI
GVSLDHISTDQVVLA


References
2 more
    Title: A calcium-gated lid and a large beta-roll sandwich are revealed by the crystal structure of extracellular lipase from Serratia marcescens
    Meier R, Drepper T, Svensson V, Jaeger KE, Baumann U
    Ref: Journal of Biological Chemistry, 282:31477, 2007 : PubMed

            

    Title: Gene cloning, sequence analysis, purification, and secretion by Escherichia coli of an extracellular lipase from Serratia marcescens
    Li X, Tetling S, Winkler UK, Jaeger KE, Benedik MJ
    Ref: Applied Environmental Microbiology, 61:2674, 1995 : PubMed

            

    Title: The lipA gene of Serratia marcescens which encodes an extracellular lipase having no N-terminal signal peptide
    Akatsuka H, Kawai E, Omori K, Komatsubara S, Shibatani T, Tosa T
    Ref: Journal of Bacteriology, 176:1949, 1994 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer