Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: sphal-q1gq33

Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) (Sphingomonas alaskensis) SpI-IsoP, Sala_2532, Dipeptidyl aminopeptidases/acylaminoacyl-peptidases-like protein

Relationship
Family|ACPH_Peptidase_S9
Block| X
Position in NCBI Life Tree|Sphingopyxis alaskensis RB2256
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Alphaproteobacteria: N E > Sphingomonadales: N E > Sphingomonadaceae: N E > Sphingopyxis: N E > Sphingopyxis alaskensis: N E > Sphingopyxis alaskensis RB2256: N E


Molecular evidence
Database
No mutation
2 structures: 5JRK, 5JRL
No kinetic





No Substrate
No inhibitor
1 Genbank : ABF54239
1 UniProt : Q1GQ33
2 Structure : 5JRL, 5JRK
1 UniProt : Q1GQ33
1 Interpro : Q1GQ33
1 Prodom : Q1GQ33
1 Pfam : Q1GQ33
1 PIRSF : Q1GQ33
1 SUPERFAM : Q1GQ33
Sequence
Graphical view for this peptide sequence: sphal-q1gq33
Colored MSA for ACPH_Peptidase_S9 (raw)
MKIALRSGLPAVALLAAAALSPAAQAGESKGRPWTLEDILTVPEVNEIAL
SDNGRLAIYAAEIADLDAGKPRSHIRIVDVETGRTKELLTVDTIKSLRSV
PGTQDWSALVDLGEGQQLYRIDTEGKLLPLIVNPNPVPVGKADMSFPLGG
GIRPSHIGILDYDWSPDGKWLWYSQLRAKSDGPRVRFDEEVTALLGRRRS
TIDVEVDFFLRNPEGDTTRIMARPSTDRVATRGGGRVLWRGNEVQFRIET
SDGTLGGAFEFVAWNRVNRTVRTLAKQRDLLSMSILVGPRGGQLSTSGLG
SDRELIETSAEGRPHSYGRVAFDIGDSRSAGWKRSRDGKRVVIGTRGLGD
ARYGLALIDKTGVRELRADASLTRCGFDGMLRSAICVEEGMSRPPRLVRV
DLGTDKITDLGPISPRHEEIEPLQTIARTFVSRDGYWSSGYVLLPRGHRA
ADRHPAVVVTHGTDADDRFAEPANQWNYPVQLLAERGYVVLLLNDPSPGQ
SKDLMDAMHAWLRGKGPPDPETVQQKLWLTGVHSFEDAVTELAAEGLIDP
ARVGIAGYSRGSQMVNVTVTNSKMFRAASSGDGGFLEPAGYATGRSSYDA
VYGGAPLSDNIERWRRFAPSLNADKVCAAVLQQVASASPSQIELFEALRA
AGVATQISYYPGATAASDETHVFYLTTNRLRAMRENIAWFDYWLLDKRDA
DAPFPDHVVKWDRLKKNLPDRCAAAP
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKIALRSGLPAVALLAAAALSPAAQAGESKGRPWTLEDILTVPEVNEIAL
SDNGRLAIYAAEIADLDAGKPRSHIRIVDVETGRTKELLTVDTIKSLRSV
PGTQDWSALVDLGEGQQLYRIDTEGKLLPLIVNPNPVPVGKADMSFPLGG
GIRPSHIGILDYDWSPDGKWLWYSQLRAKSDGPRVRFDEEVTALLGRRRS
TIDVEVDFFLRNPEGDTTRIMARPSTDRVATRGGGRVLWRGNEVQFRIET
SDGTLGGAFEFVAWNRVNRTVRTLAKQRDLLSMSILVGPRGGQLSTSGLG
SDRELIETSAEGRPHSYGRVAFDIGDSRSAGWKRSRDGKRVVIGTRGLGD
ARYGLALIDKTGVRELRADASLTRCGFDGMLRSAICVEEGMSRPPRLVRV
DLGTDKITDLGPISPRHEEIEPLQTIARTFVSRDGYWSSGYVLLPRGHRA
ADRHPAVVVTHGTDADDRFAEPANQWNYPVQLLAERGYVVLLLNDPSPGQ
SKDLMDAMHAWLRGKGPPDPETVQQKLWLTGVHSFEDAVTELAAEGLIDP
ARVGIAGYSRGSQMVNVTVTNSKMFRAASSGDGGFLEPAGYATGRSSYDA
VYGGAPLSDNIERWRRFAPSLNADKVCAAVLQQVASASPSQIELFEALRA
AGVATQISYYPGATAASDETHVFYLTTNRLRAMRENIAWFDYWLLDKRDA
DAPFPDHVVKWDRLKKNLPDRCAAAP


Reference
    Title: Structure and Mechanism of the Sphingopyxin I Lasso Peptide Isopeptidase
    Fage CD, Hegemann JD, Nebel AJ, Steinbach RM, Zhu S, Linne U, Harms K, Bange G, Marahiel MA
    Ref: Angew Chem Int Ed Engl, 55:12717, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer