Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: spitd-e0rrc2

Spirochaeta thermophila (strain ATCC 49972 / DSM 6192 / RI 19.B1) Putative uncharacterized protein

Comment
only cterm Pfam A Abhydrolase_6 97 311


Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Spirochaeta thermophila
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Spirochaetes: N E > Spirochaetia: N E > Spirochaetales: N E > Spirochaetaceae: N E > Spirochaeta: N E > Spirochaeta thermophila: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : CP001698
1 UniProt : E0RRC2
1 UniProt : E0RRC2
1 Interpro : E0RRC2
1 Pfam : E0RRC2
1 PIRSF : E0RRC2
1 SUPERFAM : E0RRC2
Sequence
Graphical view for this peptide sequence: spitd-e0rrc2
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
SRGTVLVLHGYATDSSLYGALARTLIEEEWDVVLIDLPGHGLSTGERGGA
WPDFSIYGDTVQHTLNALSPHLRRPLTAIGHSTGALALIDHTTHYPSPFI
RLVLFAPLIHTRAYSLLATAHTLTSPFVRHVRALSRTPLGLRIFPLSWFE
GLKTWEASTRLIPRIPAPPTLLILAGEDTVVDNTYNRTFLQERLPVLYTA
LVPTADHFELDSGAPHPAVLSLITRFLRNTTLHPPSGL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

SRGTVLVLHGYATDSSLYGALARTLIEEEWDVVLIDLPGHGLSTGERGGA
WPDFSIYGDTVQHTLNALSPHLRRPLTAIGHSTGALALIDHTTHYPSPFI
RLVLFAPLIHTRAYSLLATAHTLTSPFVRHVRALSRTPLGLRIFPLSWFE
GLKTWEASTRLIPRIPAPPTLLILAGEDTVVDNTYNRTFLQERLPVLYTA
LVPTADHFELDSGAPHPAVLSLITRFLRNTTLHPPSGL


Reference
    Title: Genome sequence of the polysaccharide-degrading, thermophilic anaerobe Spirochaeta thermophila DSM 6192
    Angelov A, Liebl S, Ballschmiter M, Bomeke M, Lehmann R, Liesegang H, Daniel R, Liebl W
    Ref: Journal of Bacteriology, 192:6492, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer