Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: stree-a0a0b7mbs7

Streptococcus pneumoniae. Accessory secretory protein Asp2

Comment
Other strains: Streptococcus pneumoniae (ATCC BAA-334 / TIGR4; Hungary19A-6; CGSP14; 70585; JJA; serotype 4; SP6-BS73)


Relationship
Family|Asp2
Block| X
Position in NCBI Life Tree|Streptococcus pneumoniae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Streptococcaceae: N E > Streptococcus: N E > Streptococcus pneumoniae: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
6LNW: Crystal structure of accessory secretory protein 1,2 and 3 in Streptococcus pneumoniae (protein 2 is Asp2)
No kinetic





No Substrate
No inhibitor
>3 Genbank links 20 more: CMJQ01000002, CRSC01000010, CVLS01000063
1 UniProt : A0A0B7MBS7
1 Structure : 6LNW
>3 UniProt links 7 more: A0A0B7MBS7, A0A0H2URA6, A0A0I7JCX9
>3 Interpro links 7 more: A0A0B7MBS7, A0A0H2URA6, A0A0I7JCX9
>3 Prodom links 7 more: A0A0B7MBS7, A0A0H2URA6, A0A0I7JCX9
>3 Pfam links 7 more: A0A0B7MBS7, A0A0H2URA6, A0A0I7JCX9
>3 PIRSF links 7 more: A0A0B7MBS7, A0A0H2URA6, A0A0I7JCX9
>3 SUPERFAM links 7 more: A0A0B7MBS7, A0A0H2URA6, A0A0I7JCX9
Sequence
Graphical view for this peptide sequence: stree-a0a0b7mbs7
Colored MSA for Asp2 (raw)
MSKELNILQVGLTNWENHYDIPENMNWYHFYPNSSEALREIIEKEDINRF
HAVLIEDGQYSRDLFSYVKYFEPYTLFYNQNLQINDREVVDFLKKRCAQA
IDFLSPQQLINDLSKSLFGGGYGDKLFPPTIQVNPNFTGAISYQGLDYVS
LEGEFGQDFAQLAYWAYNIMVQKTLPIELWLEYEKEGNCDFRLVIRKMWS
GSVDDFFEEVIVSEKDLEQALFMDSRDGDYFLSISVEARGRGTIKLGNLH
QRWSRKQFGKFVLGGNILHDSKRDEINYFFHPGDFKPPLTVYFAGYRPAE
GFEGYFMMKTLGCPFILFSDPRLEGGAFYLGTDELEGKVKDTITHYLDYL
GFDHKDLILSGLSMGTFPALYYGASFEPHAIIVGKPLANLGTIASRGRLD
APGVSNLAFDCLIHHTGGTSSQDMTELDQRFWKIFKQANFSKTTFGLSYM
KDEEMDPQAYEQLVSYLCNTGAKILSKGTAGRHNDDTDTNISWFLHFYRM
VLETGFGREKR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSKELNILQVGLTNWENHYDIPENMNWYHFYPNSSEALREIIEKEDINRF
HAVLIEDGQYSRDLFSYVKYFEPYTLFYNQNLQINDREVVDFLKKRCAQA
IDFLSPQQLINDLSKSLFGGGYGDKLFPPTIQVNPNFTGAISYQGLDYVS
LEGEFGQDFAQLAYWAYNIMVQKTLPIELWLEYEKEGNCDFRLVIRKMWS
GSVDDFFEEVIVSEKDLEQALFMDSRDGDYFLSISVEARGRGTIKLGNLH
QRWSRKQFGKFVLGGNILHDSKRDEINYFFHPGDFKPPLTVYFAGYRPAE
GFEGYFMMKTLGCPFILFSDPRLEGGAFYLGTDELEGKVKDTITHYLDYL
GFDHKDLILSGLSMGTFPALYYGASFEPHAIIVGKPLANLGTIASRGRLD
APGVSNLAFDCLIHHTGGTSSQDMTELDQRFWKIFKQANFSKTTFGLSYM
KDEEMDPQAYEQLVSYLCNTGAKILSKGTAGRHNDDTDTNISWFLHFYRM
VLETGFGREKR


Reference
    Title: Structural and functional insights into the Asp1/2/3 complex mediated secretion of pneumococcal serine-rich repeat protein PsrP
    Guo C, Feng Z, Zuo G, Jiang YL, Zhou CZ, Chen Y, Hou WT
    Ref: Biochemical & Biophysical Research Communications, 524:784, 2020 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer