Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strmo-q2hxd9

Streptomyces morookaensis (Streptoverticillium morookaense) puromycin hydrolase

Relationship
Family|PMH_Peptidase_S9
Block| X
Position in NCBI Life Tree|Streptomyces morookaensis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Streptomycetales: N E > Streptomycetaceae: N E > Streptomyces: N E > Streptomyces morookaense: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
3 structures: 3AZO, 3AZP, 3AZQ
No kinetic





No Substrate
No inhibitor
1 Genbank : AB220645
1 UniProt : Q2HXD9
3 Structure : 3AZO, 3AZP, 3AZQ
1 UniProt : Q2HXD9
1 Interpro : Q2HXD9
1 Prodom : Q2HXD9
1 Pfam : Q2HXD9
1 PIRSF : Q2HXD9
1 SUPERFAM : Q2HXD9
Sequence
Graphical view for this peptide sequence: strmo-q2hxd9
Colored MSA for PMH_Peptidase_S9 (raw)
MVSTAPYGAWQSPIDAALVASRSGRPACVGAVGDEVWWVAPRPAEAGRAT
LVRRRADGAEESALPAPWNVRNRVFEYSGFPWAGVPRPAGGPLLVFTHFG
DQRLYAFEPDAPGGAVPRPLTPVSAVGGGLRWADPVLLPERGEVWCMAEE
FTGEGPSDVRRFLAAVPLDGSAAADRSAVRELSDDAHRFVTGPRLSPDGR
QAVWLAWDHPRMPWEGTELKTARVTEDGRFADTRTLLGGPEEAIAQAEWA
PDGSLIVATDRTGWWNLHRVDPATGAATQLCRREEEFAGPLWTPGMRWFA
PLANGLIAVVHGKGAAVLGILDPESGELVDAAGPWTEWAATLTVSGTRAV
GVAASPRTAYEVVELDTVTGRARTIGARHTDPVDPAYYPEPQIRTFTAPD
GREIHAHIYPPHSPDFTGPADELPPYVVMAHGGPTSRVPAVLDLDVAYFT
SRGIGVADVNYGGSTGYGRAYRERLRGRWGVVDVEDCAAVATALAEEGTA
DRARLAVRGGSAGGWTAASSLVSTDVYACGTVLYPVLDLLGWADGGTHDF
ESRYLDFLIGSFEEFPERYRDRAPLTRADRVRVPFLLLQGLEDPVCPPEQ
CDRFLEAVAGCGVPHAYLSFEGEGHGFRRKETMVRALEAELSLYAQVFGV
EVAGVPLLKLGE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MVSTAPYGAWQSPIDAALVASRSGRPACVGAVGDEVWWVAPRPAEAGRAT
LVRRRADGAEESALPAPWNVRNRVFEYSGFPWAGVPRPAGGPLLVFTHFG
DQRLYAFEPDAPGGAVPRPLTPVSAVGGGLRWADPVLLPERGEVWCMAEE
FTGEGPSDVRRFLAAVPLDGSAAADRSAVRELSDDAHRFVTGPRLSPDGR
QAVWLAWDHPRMPWEGTELKTARVTEDGRFADTRTLLGGPEEAIAQAEWA
PDGSLIVATDRTGWWNLHRVDPATGAATQLCRREEEFAGPLWTPGMRWFA
PLANGLIAVVHGKGAAVLGILDPESGELVDAAGPWTEWAATLTVSGTRAV
GVAASPRTAYEVVELDTVTGRARTIGARHTDPVDPAYYPEPQIRTFTAPD
GREIHAHIYPPHSPDFTGPADELPPYVVMAHGGPTSRVPAVLDLDVAYFT
SRGIGVADVNYGGSTGYGRAYRERLRGRWGVVDVEDCAAVATALAEEGTA
DRARLAVRGGSAGGWTAASSLVSTDVYACGTVLYPVLDLLGWADGGTHDF
ESRYLDFLIGSFEEFPERYRDRAPLTRADRVRVPFLLLQGLEDPVCPPEQ
CDRFLEAVAGCGVPHAYLSFEGEGHGFRRKETMVRALEAELSLYAQVFGV
EVAGVPLLKLGE


References
    Title: Structural evidence that puromycin hydrolase is a new type of aminopeptidase with a prolyl oligopeptidase family fold
    Matoba Y, Nakayama A, Oda K, Noda M, Kumagai T, Nishimura M, Sugiyama M
    Ref: Proteins, 79:2999, 2011 : PubMed

            

    Title: Molecular cloning and characterization of gene encoding novel puromycin-inactivating enzyme from blasticidin S-producing Streptomyces morookaensis
    Nishimura M, Ikeda K, Sugiyama M
    Ref: J Biosci Bioeng, 101:63, 2006 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer