Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: strmu-SMU.1393C

Streptococcus mutans conserved hypothetical protein

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Streptococcus mutans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Bacilli: N E > Lactobacillales: N E > Streptococcaceae: N E > Streptococcus: N E > Streptococcus mutans: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
4L9A: Crystal structure of Smu.1393c from Streptococcus mutans UA159 (3L80 superceded by 4L9A)
No kinetic





No Substrate
No inhibitor
1 Genbank : AE014972
1 Structure : 4L9A
1 UniProt : Q8DTF4
1 Interpro : Q8DTF4
1 Prodom : Q8DTF4
1 Pfam : Q8DTF4
1 PIRSF : Q8DTF4
1 SUPERFAM : Q8DTF4
Sequence
Graphical view for this peptide sequence: strmu-SMU.1393C
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MAALNKEMVNTLLGPIYTCHREGNPCFVFLSGAGFFSTADNFANIIDKLP
DSIGILTIDAPNSGYSPVSNQANVGLRDWVNAILMIFEHFKFQSYLLCVH
SIGGFAALQIMNQSSKACLGFIGLEPTTVMIYRAGFSSDLYPQLALRRQK
LKTAADRLNYLKDLSRSHFSSQQFKQLWRGYDYCQRQLNDVQSLPDFKIR
LALGEEDFKTGISEKIPSIVFSESFREKEYLESEYLNKHTQTKLILCGQH
HYLHWSETNSILEKVEQLLSNHEKL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAALNKEMVNTLLGPIYTCHREGNPCFVFLSGAGFFSTADNFANIIDKLP
DSIGILTIDAPNSGYSPVSNQANVGLRDWVNAILMIFEHFKFQSYLLCVH
SIGGFAALQIMNQSSKACLGFIGLEPTTVMIYRAGFSSDLYPQLALRRQK
LKTAADRLNYLKDLSRSHFSSQQFKQLWRGYDYCQRQLNDVQSLPDFKIR
LALGEEDFKTGISEKIPSIVFSESFREKEYLESEYLNKHTQTKLILCGQH
HYLHWSETNSILEKVEQLLSNHEKL


References
    Title: Harnessing Nature's Diversity: Discovering organophosphate bioscavenger characteristics among low molecular weight proteins
    Jacob RB, Michaels KC, Anderson CJ, Fay JM, Dokholyan NV
    Ref: Sci Rep, 6:37175, 2016 : PubMed

            

    Title: Structural and functional characterization of a novel alpha/beta hydrolase from cariogenic pathogen Streptococcus mutans
    Wang Z, Li L, Su XD
    Ref: Proteins, 82:695, 2014 : PubMed

            

    Title: Genome sequence of Streptococcus mutans UA159, a cariogenic dental pathogen
    Ajdic D, McShan WM, McLaughlin RE, Savic G, Chang J, Carson MB, Primeaux C, Tian R, Kenton S and Ferretti JJ <9 more author(s)>
    Ref: Proceedings of the National Academy of Sciences of the United States of America, 99:14434, 2002 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer