Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: therp-b9l0x7

Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) Lipase TrLip

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Thermomicrobium roseum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Chloroflexi: N E > Thermomicrobia: N E > Thermomicrobiales: N E > Thermomicrobiaceae: N E > Thermomicrobium: N E > Thermomicrobium roseum: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : ACM04789, WP_015922630
1 UniProt : B9L0X7
1 UniProt : B9L0X7
1 Interpro : B9L0X7
1 Prodom : B9L0X7
1 Pfam : B9L0X7
1 PIRSF : B9L0X7
1 SUPERFAM : B9L0X7
Sequence
Graphical view for this peptide sequence: therp-b9l0x7
Colored MSA for Hormone-sensitive_lipase_like (raw)
MSVFARLDPELAAALREIPEEFLLDLRDISLARRRLQILREALASLLPPL
PSDVAVTDELAPNSFDGTMVRVRLYRPSEVTGPLPVLLWIHGGGYVMGAP
EMNDQQCAELAQRIPALVASVDYRLAPEHPYPAPLEDCYAALRWVAERAE
QLGVDRERLAIAGASAGGGLAAGLALLARDRGEVPVRFQLLIYPMLDDRN
QTPSSYEITDPRLIWTRDWNLIGWRAYLGREPGSPDVPPYAAPARADDLA
GLPPAYVLVGTADLFRDEDIAYAQRLMQAGVPTELHVFAGAFHGFDVFAP
TAWVSQRANAEVLAVLQRALAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSVFARLDPELAAALREIPEEFLLDLRDISLARRRLQILREALASLLPPL
PSDVAVTDELAPNSFDGTMVRVRLYRPSEVTGPLPVLLWIHGGGYVMGAP
EMNDQQCAELAQRIPALVASVDYRLAPEHPYPAPLEDCYAALRWVAERAE
QLGVDRERLAIAGASAGGGLAAGLALLARDRGEVPVRFQLLIYPMLDDRN
QTPSSYEITDPRLIWTRDWNLIGWRAYLGREPGSPDVPPYAAPARADDLA
GLPPAYVLVGTADLFRDEDIAYAQRLMQAGVPTELHVFAGAFHGFDVFAP
TAWVSQRANAEVLAVLQRALAA


Reference
    Title: Ancestral sequence reconstruction and spatial structure analysis guided alteration of longer-chain substrate catalysis for Thermomicrobium roseum lipase
    Ma D, Xin Y, Guo Z, Shi Y, Zhang L, Li Y, Gu Z, Ding Z, Shi G
    Ref: Enzyme Microb Technol, 156:109989, 2022 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer