Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: tutab-ACHE1

Tuta absoluta (South American tomato moth) (Tomato leafminer) acetylcholinesterase

Relationship
Family|ACHE
Block| C
Position in NCBI Life Tree|Tuta absoluta
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Panarthropoda: N E > Arthropoda: N E > Mandibulata: N E > Pancrustacea: N E > Hexapoda: N E > Insecta: N E > Dicondylia: N E > Pterygota: N E > Neoptera: N E > Holometabola: N E > Amphiesmenoptera: N E > Lepidoptera: N E > Glossata: N E > Neolepidoptera: N E > Heteroneura: N E > Ditrysia: N E > Gelechioidea: N E > Gelechiidae: N E > Gelechiinae: N E > Tuta: N E > Tuta absoluta: N E


Molecular evidence
Database
1 mutation: tutab-ACHE1
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KU985167
1 UniProt : A0A218KFK3
1 UniProt : A0A218KFK3
1 Interpro : A0A218KFK3
1 Prodom : A0A218KFK3
1 Pfam : A0A218KFK3
1 PIRSF : A0A218KFK3
1 SUPERFAM : A0A218KFK3
Sequence
Graphical view for this peptide sequence: tutab-ACHE1
Colored MSA for ACHE (raw)
ELDTILPRIEDHETSSKRSKIEDETSSKRVKFDTYYSNHERAEEVLMADD
PNLGPEEDDPLVVRTRKGRVRGITLTAVTGKKVDAWFGIPYAQKPIGDLR
FRHPRPTEGWGEEILNTTTLPHSCVQIIDNVFGDFPGAMMWNPNTDMQED
CLYINIVVPKPRPKNAAVMLWVFGGGFYSGTATLDVYDPKILVSEEKVVY
VSMQYRVASLGFLFFDTPDVPGNAGLFDQLMALQWVKDNIAYFGGNPHNV
TLFGESSGAASVSLHLLSPLSRNYFSQAIMQSGAATLPWAIISREESILR
GIRLAEAVHCPYSRNDVGPMIECLRKKTPEELVNNEWGTLGICEFPFVPI
IDGSFLDEMPARSLAHQNFKKTNLLMGSNTEEGYYFILYYLTEMMPKEEN
VGISREQYLQAVKELNPYVNDIVRQAIVYEYTDWLNPNDPVKNRNALDKM
VGDYHFTCSVNEFAHRYAETGNNVYTYYYKHRSKNNPWPSWTGVLHADEI
NYVFGEPLNPGKNYSPEEVEFSKRIMRYWSNFARTGNPSMNPNGELTNPV
WPLHSPLGREYLALGVNESSVGQGVRVKECAFWQKYLPQLIAATSKPDPP
KNCTSSA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

ELDTILPRIEDHETSSKRSKIEDETSSKRVKFDTYYSNHERAEEVLMADD
PNLGPEEDDPLVVRTRKGRVRGITLTAVTGKKVDAWFGIPYAQKPIGDLR
FRHPRPTEGWGEEILNTTTLPHSCVQIIDNVFGDFPGAMMWNPNTDMQED
CLYINIVVPKPRPKNAAVMLWVFGGGFYSGTATLDVYDPKILVSEEKVVY
VSMQYRVASLGFLFFDTPDVPGNAGLFDQLMALQWVKDNIAYFGGNPHNV
TLFGESSGAASVSLHLLSPLSRNYFSQAIMQSGAATLPWAIISREESILR
GIRLAEAVHCPYSRNDVGPMIECLRKKTPEELVNNEWGTLGICEFPFVPI
IDGSFLDEMPARSLAHQNFKKTNLLMGSNTEEGYYFILYYLTEMMPKEEN
VGISREQYLQAVKELNPYVNDIVRQAIVYEYTDWLNPNDPVKNRNALDKM
VGDYHFTCSVNEFAHRYAETGNNVYTYYYKHRSKNNPWPSWTGVLHADEI
NYVFGEPLNPGKNYSPEEVEFSKRIMRYWSNFARTGNPSMNPNGELTNPV
WPLHSPLGREYLALGVNESSVGQGVRVKECAFWQKYLPQLIAATSKPDPP
KNCTSSA


References
    Title: Population structure and insecticide resistance status of Tuta absoluta populations from Turkey
    Inak E, Ozdemir E, Atis AE, Randa Zelyut F, Inak A, Demir U, Roditakis E, Vontas J
    Ref: Pest Manag Sci, :, 2021 : PubMed

            

    Title: Mutation in the ace-1 gene of the tomato leaf miner (Tuta absoluta) associated with organophosphates resistance
    Haddi K, Berger M, Bielza P, Rapisarda C, Williamson MS, Moores GD, Bass C
    Ref: J.Appl_Entomol, 141:612, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer