Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: vigra-e5l4l1

Vigna radiata (Mung bean) Epoxide hydrolase A

Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|Vigna radiata
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > fabids: N E > Fabales: N E > Fabaceae: N E > Papilionoideae: N E > Phaseoleae: N E > Vigna: N E > Vigna radiata: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
5XMD: Crystal structure of epoxide hydrolase VrEH1 from Vigna radiata
No kinetic





No Substrate
No inhibitor
2 Genbank : ADP68585, A0A515CWY1
1 UniProt : E5L4L1
1 Structure : 5XMD
1 UniProt : E5L4L1
1 Interpro : E5L4L1
1 Pfam : E5L4L1
1 PIRSF : E5L4L1
1 SUPERFAM : E5L4L1
Sequence
Graphical view for this peptide sequence: vigra-e5l4l1
Colored MSA for Epoxide_hydrolase (raw)
MEEIEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSSR
GYRAVAPDLRGYGDTEAPESISSYTIMHLVGDIVALIDSLGVGQVFLVAH
DWGAIVGWYLCLFRPEKIKAYVCLSVPFMPRNPKVRPVDAMRALYGDDYY
ICRFQEPGKAEALYGSNNNIGEVIKSILTNRRPGPPILPKEGVALPSGSL
PSRPLPSWLSEEDVTYYASKFSKTGLTGGLNYYRNLNLNWELTAAWTGAK
VKVPVKFITGDLDVVYTSLGIKDYIDSGAFKRDVHYLEEVVVQEGVAHFN
NQEAAEDISNHIYEFIKKF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEEIEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSSR
GYRAVAPDLRGYGDTEAPESISSYTIMHLVGDIVALIDSLGVGQVFLVAH
DWGAIVGWYLCLFRPEKIKAYVCLSVPFMPRNPKVRPVDAMRALYGDDYY
ICRFQEPGKAEALYGSNNNIGEVIKSILTNRRPGPPILPKEGVALPSGSL
PSRPLPSWLSEEDVTYYASKFSKTGLTGGLNYYRNLNLNWELTAAWTGAK
VKVPVKFITGDLDVVYTSLGIKDYIDSGAFKRDVHYLEEVVVQEGVAHFN
NQEAAEDISNHIYEFIKKF


Reference
    Title: Heterologous overexpression of Vigna radiata epoxide hydrolase in Escherichia coli and its catalytic performance in enantioconvergent hydrolysis of p-nitrostyrene oxide into (R)-p-nitrophenyl glycol
    Zhu QQ, He WH, Kong XD, Fan LQ, Zhao J, Li SX, Xu JH
    Ref: Applied Microbiology & Biotechnology, 98:207, 2014 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer