Presegetalin-B1

General

Type : Peptide

Chemical_Nomenclature : MSPILAHDVVKPQGVAWAFQAKDVENASAPV

Canonical SMILES :

InChI :

InChIKey :

Other name(s) :


MW :

Formula :

CAS_number :

PubChem :

UniChem :

Target

Families : Presegetalin-B1 ligand of proteins in family
S9N_PPCE_Peptidase_S9

Structure :
5O3V

Protein :
9cary-r4p353

References (3)

Title : Characterization of the Fast and Promiscuous Macrocyclase from Plant PCY1 Enables the Use of Simple Substrates - Ludewig_2018_ACS.Chem.Biol_13_801
Author(s) : Ludewig H , Czekster CM , Oueis E , Munday ES , Arshad M , Synowsky SA , Bent AF , Naismith JH
Ref : ACS Chemical Biology , 13 :801 , 2018
Abstract :
PubMedSearch : Ludewig_2018_ACS.Chem.Biol_13_801
PubMedID: 29377663
Gene_locus related to this paper: 9cary-r4p353

Title : Characterization of the Fast and Promiscuous Macrocyclase from Plant PCY1 Enables the Use of Simple Substrates - Ludewig_2018_ACS.Chem.Biol_13_801
Author(s) : Ludewig H , Czekster CM , Oueis E , Munday ES , Arshad M , Synowsky SA , Bent AF , Naismith JH
Ref : ACS Chemical Biology , 13 :801 , 2018
Abstract :
PubMedSearch : Ludewig_2018_ACS.Chem.Biol_13_801
PubMedID: 29377663
Gene_locus related to this paper: 9cary-r4p353

Title : Characterization of the Fast and Promiscuous Macrocyclase from Plant PCY1 Enables the Use of Simple Substrates - Ludewig_2018_ACS.Chem.Biol_13_801
Author(s) : Ludewig H , Czekster CM , Oueis E , Munday ES , Arshad M , Synowsky SA , Bent AF , Naismith JH
Ref : ACS Chemical Biology , 13 :801 , 2018
Abstract :
PubMedSearch : Ludewig_2018_ACS.Chem.Biol_13_801
PubMedID: 29377663
Gene_locus related to this paper: 9cary-r4p353