Presegetalin-F1
General
Type : Peptide
Chemical_Nomenclature : MATSFQFDGLKPSFSASYSSKPIQTQVSNGMDNASAPV
Canonical SMILES :
InChI :
InChIKey :
Other name(s) :
MW :
Formula :
CAS_number :
PubChem :
UniChem :
Target
Families : Presegetalin-F1 ligand of proteins in family
S9N_PPCE_Peptidase_S9
Structure :
5O3U
Protein :
9cary-r4p353
References (3)
| Title : Characterization of the Fast and Promiscuous Macrocyclase from Plant PCY1 Enables the Use of Simple Substrates - Ludewig_2018_ACS.Chem.Biol_13_801 |
| Author(s) : Ludewig H , Czekster CM , Oueis E , Munday ES , Arshad M , Synowsky SA , Bent AF , Naismith JH |
| Ref : ACS Chemical Biology , 13 :801 , 2018 |
| Abstract : |
| PubMedSearch : Ludewig_2018_ACS.Chem.Biol_13_801 |
| PubMedID: 29377663 |
| Gene_locus related to this paper: 9cary-r4p353 |
| Title : Characterization of the Fast and Promiscuous Macrocyclase from Plant PCY1 Enables the Use of Simple Substrates - Ludewig_2018_ACS.Chem.Biol_13_801 |
| Author(s) : Ludewig H , Czekster CM , Oueis E , Munday ES , Arshad M , Synowsky SA , Bent AF , Naismith JH |
| Ref : ACS Chemical Biology , 13 :801 , 2018 |
| Abstract : |
| PubMedSearch : Ludewig_2018_ACS.Chem.Biol_13_801 |
| PubMedID: 29377663 |
| Gene_locus related to this paper: 9cary-r4p353 |
| Title : Characterization of the Fast and Promiscuous Macrocyclase from Plant PCY1 Enables the Use of Simple Substrates - Ludewig_2018_ACS.Chem.Biol_13_801 |
| Author(s) : Ludewig H , Czekster CM , Oueis E , Munday ES , Arshad M , Synowsky SA , Bent AF , Naismith JH |
| Ref : ACS Chemical Biology , 13 :801 , 2018 |
| Abstract : |
| PubMedSearch : Ludewig_2018_ACS.Chem.Biol_13_801 |
| PubMedID: 29377663 |
| Gene_locus related to this paper: 9cary-r4p353 |