Type : Natural || Toxin || Macrocycle || Peptide
Chemical_Nomenclature :
Canonical SMILES :
InChI :
InChIKey :
Other name(s) : MFDTNATRLPIWGIGCNPWTAEHVDQTLASGNDIC, Alpha-amanitin proprotein, H2E7Q5, AMA1-1, AEX26935
MW :
Formula :
CAS_number :
PubChem :
UniChem :
Iuphar :
Families : S9N_PPCE_Peptidase_S9
Title : Characterization of a dual function macrocyclase enables design and use of efficient macrocyclization substrates - Czekster_2017_Nat.Commun_8_1045 |
Author(s) : Czekster CM , Ludewig H , McMahon SA , Naismith JH |
Ref : Nat Commun , 8 :1045 , 2017 |
PubMedID: 29051530 |
Gene_locus related to this paper: 9agar-h2e7q8 |