25mer macrocyclization substrate: IWGIGCNPWTAEHVDQTLASGNDIC. The 25mer is the post proline product (A0A067SLB9 AAMA1_GALM3) Major toxin belonging to the bicyclic octapeptides amatoxins that acts by binding non-competitively to RNA polymerase II and greatly slowing the elongation of transcripts from target promoters
Type : Natural, Toxin, Macrocycle, Peptide
Chemical_Nomenclature :
Canonical SMILES :
InChI :
InChIKey :
Other name(s) : MFDTNATRLPIWGIGCNPWTAEHVDQTLASGNDIC || Alpha-amanitin proprotein || H2E7Q5 || AMA1-1 || AEX26935
MW :
Formula :
CAS_number :
PubChem :
UniChem :
Structures : 5N4B, 5N4C, 5N4D, 5N4E
Families : S9N_PPCE_Peptidase_S9
| Title : Characterization of a dual function macrocyclase enables design and use of efficient macrocyclization substrates - Czekster_2017_Nat.Commun_8_1045 |
| Author(s) : Czekster CM , Ludewig H , McMahon SA , Naismith JH |
| Ref : Nat Commun , 8 :1045 , 2017 |
| Abstract : |
| PubMedSearch : Czekster_2017_Nat.Commun_8_1045 |
| PubMedID: 29051530 |
| Gene_locus related to this paper: 9agar-h2e7q8 |
| Title : Characterization of a dual function macrocyclase enables design and use of efficient macrocyclization substrates - Czekster_2017_Nat.Commun_8_1045 |
| Author(s) : Czekster CM , Ludewig H , McMahon SA , Naismith JH |
| Ref : Nat Commun , 8 :1045 , 2017 |
| Abstract : |
| PubMedSearch : Czekster_2017_Nat.Commun_8_1045 |
| PubMedID: 29051530 |
| Gene_locus related to this paper: 9agar-h2e7q8 |
| Title : Characterization of a dual function macrocyclase enables design and use of efficient macrocyclization substrates - Czekster_2017_Nat.Commun_8_1045 |
| Author(s) : Czekster CM , Ludewig H , McMahon SA , Naismith JH |
| Ref : Nat Commun , 8 :1045 , 2017 |
| Abstract : |
| PubMedSearch : Czekster_2017_Nat.Commun_8_1045 |
| PubMedID: 29051530 |
| Gene_locus related to this paper: 9agar-h2e7q8 |