Alpha-amanitin-proprotein

25mer macrocyclization substrate: IWGIGCNPWTAEHVDQTLASGNDIC. The 25mer is the post proline product (A0A067SLB9 AAMA1_GALM3) Major toxin belonging to the bicyclic octapeptides amatoxins that acts by binding non-competitively to RNA polymerase II and greatly slowing the elongation of transcripts from target promoters

General

Type : Natural, Toxin, Macrocycle, Peptide

Chemical_Nomenclature :

Canonical SMILES :

InChI :

InChIKey :

Other name(s) : MFDTNATRLPIWGIGCNPWTAEHVDQTLASGNDIC  ||  Alpha-amanitin proprotein  ||  H2E7Q5  ||  AMA1-1  ||  AEX26935


MW :

Formula :

CAS_number :

PubChem :

UniChem :

Target

Structures : 5N4B, 5N4C, 5N4D, 5N4E

Families : S9N_PPCE_Peptidase_S9

References (1)

Title : Characterization of a dual function macrocyclase enables design and use of efficient macrocyclization substrates - Czekster_2017_Nat.Commun_8_1045
Author(s) : Czekster CM , Ludewig H , McMahon SA , Naismith JH
Ref : Nat Commun , 8 :1045 , 2017
Abstract :
PubMedSearch : Czekster_2017_Nat.Commun_8_1045
PubMedID: 29051530
Gene_locus related to this paper: 9agar-h2e7q8