Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: Aclacinomycin-methylesterase_RdmC

Aclacinomycin-methylesterase_RdmC


Genes:Proteins in Aclacinomycin-methylesterase_RdmC (213)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9acto-b5g999: Streptomyces sp. SPB74 Carboxyl esteraseStreptomyces sp. SPB74 Show
MSATTRPVSLAHDTFGDPADPAVLLVAGFGSQMISWHEDFCRELAAEGRY
VIRYDNRDCGLSTRFDAYPVALDEFVAAVSAGDIETAKAMIPYRLSDMAA
DGMDLLTRLGIERAHVVGASMGGMIAQTMAIHHPGRVLSLTSMMSSTGEP
GYGDSTPEAQAALFAPRPSDREGFIASADRELVWASRRYGDLAALRELAA
RSFDRGYFPAGTARQLGAMILSGDRAAQLRALTVRTLVIHGLDDTLIDPS
GGRRTAQLVPGARLLLVPDMGHDRPRELWPTLITALTRHTAPRAA
9acto-b5hp47: Streptomyces sviceus ATCC 29083 Putative uncharacterized proteinStreptomyces sviceus ATCC 29083 Show
MTTVNARGIVLGIESFGDHDAPLVLLAGGTTMLSWPDALCERLAAEGRRV
VRYDLRDSGESTTTDPTAPAYTLRDLATDAAALADALGGGPAHLAGIGVG
GMVAQVAVLDHPDAFSALTLVGTRAVAPGPVDEDLPDHDQATMRQLFARV
MPDWTDREAVAAFAAAGAEILGDDPVAAHATAARIWDRTPGTAPPVQMAN
QMGVVFAGLDCEPRWRERLPEIEVPTLVVHGRRNPFFPVGNGEAIARDIP
GARMLVLEEAATAIPDAAVGELTEAMLSLE
9acto-d1xnm4: Streptomyces sp. ACTE Alpha/beta hydrolase fold proteinStreptomyces sp. ACTE Show
MERFIDVTPEVRLWAEERGAVDAPPLLLIMGAQASGLGWPDELVDALAVR
HRVIRYDHRDTGRSTWAFDEAPYALTELAHDAIAVLDAFGVARAHVVGMS
MGGMLTQLLIADHPERMLSATLLGTSALSTAPYVRPDGTRVPPEELPGIA
PHILELWARPVEDHGLEAELDRRVEHWRALGGDGLPFDAEATRDSERRVI
EHTGHHTAGTAHARADAADMLRTEQLAATDVPTLVVAAPADPLFPPPHPQ
HLAQVIRGARLTEIPGMGHALPHEVLAPLTAAILGHTARH
9acto-d3ctl7: Frankia sp. EUN1f Alpha/beta hydrolase fold proteinFrankia sp. EUN1f Show
AGQDERFCDLPNGMRLCYRIDEPDQSDQSSQSGQSGQSGQSDPGGTVPVL
LIAGLSLDLASWPESMVAGLVSGGLRVIRFDNRDVGRTTFPTASPPPPPP
GRARLLLARPRPDAYSLVAMVEDTVGLLDQLGVARAHVVGMSMGGMIAQS
LAARHGERVATLTSIFSTTGARQVGQPARSTLRLMAGRPPRDREEAVARH
LALLGHIGSTTYPPDVDVESDWAARAWDRGPGPRGRAGVARQIGAIQASG
NRTASLAAVTAPTLVIHGDADLMVHPSGGRATATAITGARHVEITGLRHH
LAPGVVDQLVELITDHTGTARPASTTHPAGEAQAAGNARTA
9acto-d3cww2: Frankia sp. EUN1f Alpha/beta hydrolase fold proteinFrankia sp. EUN1f Show
MRIVPANGIELAVETHGDPDGLPLLLVGGLGQHLVGWHPDLVASMVRRGY
HVITFDNRDVGHSTHLDWHGPPDLLGIVSGQTALAPYGLEDMAADTIGLL
DALGVESAHVFGVSLGGMVAQLLALNSPDRVRSLTSVMSHPGDHSVKPSD
EAVELLLRPSPTSLDEFIARAEESARVIGSPEFAVDVPWLHSRSRQLWER
RQNPAGVARQLAAILVAADRSAALRGLRVPTLVVHGTHDPLIPVRGGRLT
AATVPSAELLEIDGMAHDLPREIWERLLDRVDDVTYHGESLRAAVQ
9acto-d3m5d4: Frankia symbiont of Datisca glomerata Alpha/beta hydrolase fold proteinFrankia symbiont of Datisca glomerata Show
MGTVQANGIEIAYELHGDSGGLPLVLVGELGQQLVGWHPDLIRAMVRRGF
QVLVYDNRDVGFSTHFDQLGQPDLVAVMSGNADAAPYTLDDMAADAVGLM
DALGWRSAHIFGISMGGMIAQIVALSFPDRVRSLTSVSATTGSHGVGHAA
RDATAVVLRPMVASREAYADGAERAHNIIGSAEFSPDREWIRRQAGLAWE
RRYDPHGTARHLTAILAAGDLTPDLARLEIPALIVHGANDPLIPVASGRL
TAAAIPSAELLEIDGMGHDIPRQVWDRLLDKLDDVAHRGEVAAAARRASA
SISSFGHS
9alte-a6f626: Marinobacter algicola DG893 Predicted Hydrolase or acyltransferase (Alpha/beta hydrolase superfamily) proteinMarinobacter algicola DG893 Show
MPETLSRSDWHSADTSVNAMPETIHVQAGELSFCVETRGDPAGEPVIFVM
GLGAQMTLWPEALLNQYVCEGYRVIRFDNRDIGLSSHLKDRLEGHPVAVM
ARHRMGLPIAAPYTLHDMADDVCHVMDALSLASAHLVGVSMGGMISQLVA
ANRPERVRSATLIMTSTNSPRLPMPKSKLIWRLAGIGAKGHDEAAVVARS
LDFWRAIQSPGYPPREQEVRDRIVREFRRSYHSAGILRQTRAILATGSLS
SATRRIRVPVSVIHGKADPLVRPVAAEQLGYLMPHARVEMIEGMGHDLPE
PLLSRFAGIGFETMAQQPRQGNG
9bact-a9ukk2: uncultured bacterium Lipase/esteraseuncultured bacterium Show
MARVRTNGIELEYEVLGPEHGQPMVLIMGLGAQMILWRDDFCQMLVEHGY
RVIRFDNRDVGRSTWLDHLGLPNVMGLMAAAAAGQPVDAPYKLSDMAADT
AGLLDALGISQAHIVGASMGGMIAQTFAIEYPERALSLTSIMSTTGDPTL
PPPRPEALSVLLAPQPSSREEAIERGVLIFRTIGSPKYFDEAEIRELAAR
AFDRGINPAGVMRQLAAILASGNRTEALRKVDQPALVIHGRIDPLVPFAA
GEATARALPRAELLAFEDMGHDMPRPLWPAMVDAIHRVAQQARQR
9bact-b0l3i3: uncultured bacterium Lipase/esterase, 1 reference(s)uncultured bacterium Show
MARVRANGIELEYDHFGSPSGRPLLLIMGLGGQLLMWDEGFCEALAARGH
YVVRFDNRDVGLSTRFGAAGVPNVLELMQRSAAGETLAVPYSLDDMADDA
AALLGALGLESAHVCGASMGGMIAQTLAIRHGGRLRSLTSIMSTTGNPEL
PPAKPEAMAVLLTPPPTDRAGSLDAAVRTWRTIGSPGFPFDEAKIRARAG
RLYDRAFYPEGIARQLAAVLAHGSRAPQLRGVSVPTLVIHGAADPLVPLA
GGQDTARSIPGAELLVIEGMGHDLPEGAWPALVGAISEHTAKAEARRT
9bact-b8y566: uncultured bacterium Lipolytic enzyme, 1 reference(s)uncultured bacterium Show
MAITNANGIQIEYDTFGKSGEPALLLIVGLANQLIHWDEALCQQLARRGH
YVIRFDNRDAGLSTKLAEAGIPDIGQIMEARRKGEEIKPPYTIEDMADDA
VGLLDALGIEAAHICGMSMGGMIAQTIALNHRQRVLSLISIYSHTGNPAL
PEPKPEALEILFTRPPEERQANIEYALKVFRTLSGSGFPLDEEWHRNIAA
QAYDRAFYPEGVARQLAAVLTQKNRKSELGSVCVPTLVIHGADDLLVPVE
GGKDTAAAVPEAELIIIDGMGHDLPHAGAWPQIIDAIVGHTHKAARPKSR
S
9bact-c3rww3: uncultured bacterium Putative lipase/esteraseuncultured bacterium Show
MANIIANGIQIEYDTFGNPDEPPLLLIMGLACQLIHWDEDLCEQLARRGH
YVIRFDNRDTGLSTKFAEAGIPDIGQIIEARMKGEEFRPPYTLEDMADDA
VGLLDALEIEKAHVCGMSMGGMIAQTIGLNHQQRVLSLISIYSHTGNPEL
PPPTPEALEYLVTPPPMEREANITYTLDVWRTFSGKGFPLDEDWNRKIAA
KAYDRAFYPEGVARQMAAVLTQKNRKFELGSVTMPTLVIHGADDPLVPVE
GGKDTAEAIPGAELIIIDGMGHDLPHGGAWPQIVDAIVNHTQKIFI
9bact-estC55.197: uncultured bacterium. Lipolytic protein, 1 reference(s)uncultured bacterium Show
MTAMPIARANGIDIAYETLGDPADPTVLLVHGLGCQLIEWDDELCRAIVD
RGFHVVRFDNRDVGESTRFDQPVDVMGVIAAVAAGEVPEVPYLLSDMAAD
AVGLLDHLGVDRAHVLGVSMGGMIVQTMAIEHGARLRSMTSIMSTTGDPD
VGMPTGEAMSTLLSPPPHDPGGACRTPPSATTGVWGSPGLYDEARLREVA
GRKWDRGYDPAGTARQLAAILASGSRSAGLATVDVPTLVIHGTADKLVQP
SGGERTAEVVPDAKLLMIEGMGHDLPPPLWGGYVERVRGHIATEHP
9bact-g3c5s9: uncultured bacterium. Lipase/esteraseuncultured bacterium Show
MGMRQTQANGITVNFEDLGPADGRPILFVNGYTSTMMSWPAELMDGLRAR
GFRVIRYDNRDVGHSEKLKGMPDIRAVAAAVREGSRPDIPYTLSDMAADG
IGVLDALGIARAHVMGISMGGMIVQTMAIDHPGRLLSVTSIMSTTGNPDL
PKASEAAMAALQEQPPAQDRETVIRHRMKGRRVYQSPAYPMTDEALHARC
AAEFDHMYYPEGASRQYAAIVGDGSRVERLKAVRVPFLVIHGLADPLVPP
EGGVDTANSVPGANLELIEGMGHDLPAELCPRFVELIAEHALAAEKENAA
E
9bact-g3c5t0: uncultured bacterium. Lipase/esteraseuncultured bacterium Show
MPQVQANGITIEYESFGPANRETVLLIMGLGGQLTMWPTELCNELVQRGY
RAIRFDNRDVGLSTKFDEAGMPDMAAIFGALMSGQKANAPYSLDDMAADA
VGLLDALGIEKAHIAGASMGGMIAQLVTANHPERVLSLTSIMSTTGNPAL
PQAKPEAMEVLMSPAAPEGDWEAIIARGIKAWKTIGSPGFPTDEKILREW
VMRDAKRSFYPVGVARQMAAIVANGDRREKLKNIAVPAVVLHGADDPLVP
VEGGKDTAANIPGAELRIIPGMGHDFPVALVGTFADAITAATKRAAAARA
AE
9burk-a6gu41: Limnobacter sp. MED105 Alpha/beta hydrolase superfamily protein interrupted gene pseudogeneLimnobacter sp. MED105 Show
MKAASNPIEWQQGFAKSSTTGLNMAWESAGPTDGETIFMVAGLGCQLTMW
NDEFCAPLLQRGYRLVRFDNRDIGLTDQHPTSMKVNVPATFIRNKLGLPT
PTNYKLDTMANDAIGLIDALELKRPHLLGISMGGMISQIVAAKAPEKIGK
LVTLMSSTNNPKLPMPDVVAHVERVFTAIGSPGYPPDPLKLRERARKSYN
RAYKPAGVLRQTHCVVATGSIEDYTREIRVPTCVIHGLDDPLLKKACSER
IAKLVPDSRLHLIKGLGHDLPEPLAPTFAEIIHSHLS
9burk-c9y9d4: Curvibacter putative symbiont of Hydra magnipapillata Putative uncharacterized protein, 1 reference(s)Curvibacter putative symbiont of Hydra magnipapillata Show
MKIRANGIEIEVEDSATQDASFAAKPAVLLIMGLGLQLIAWPPDMVQGLE
DAGYRVIRFDNRDVGLSTRMDAAGKPNLMWASLQYKLGFTPAAPYSLSDM
AADAIGVLDALGVRQAHVVGVSMGGMIAQRVALAVPQRVLSLTSIMSSSG
AKGLPGPTPEVLRAMLSRPTGSSKAAVIEHSLALFRAIGSPAFPLPEADL
RARITRGVERAFYPVGTLRQMVAVVSDHARAALLGRIAAPTLVVHGTADP
LVPLACGQDTARRIPGAKLVTIDGMGHDLPPEPVRRILAALLSHITAHPA
V
9delt-q5md37: Cystobacter fuscus hypothetical proteinCystobacter fuscus Show
MAERMVKSNGIELWTESFGEPGNPPILLVMGASAQGLLWPEEFIELLVAG
GHYVIRYDHRDTGQSTCLDFQTNPYTLEDLARDALGVLDAYGIAAAHLVG
ASLGGMICQLMSIRHPERVRSLTVMMSTPLRPGIMESFQQAFQGKTPEGA
FPPPAPRAIAVQLAAASNPPRNREEAIDFQVKMARTMAASAAPFDEQECR
RMVERMFDRARNPAAAMNHGFVPSPTHEQAEALRHLRVPTLVIHGTDDPM
FPAAHGVAVAERISGAKLLMLEGMGHDLPRPLFGEISRALLTHTGARA
9entr-b6xhq2: Providencia alcalifaciens DSM 30120 Putative uncharacterized proteinProvidencia alcalifaciens DSM 30120 Show
MTETTPLSLYYDTFGQPANPAVILIAGLGGHNISWTSEFCQQIADAGFYI
IRPDNRDAGLSPHLDNYPPLNIKELSERLQRGEQVDVPYTLFEMADDIIG
LLDQLSIEKAHVVGRSMGGMIAQVVASKVPERILSLCPIMSSTGNPQLPQ
GEPDVMQMLMSPGVDPKQDFEGYLAGQIAFNRRIASTCVPFDEENCRNYI
VQAFQRNYSPEGTKRQLAAVAVTGDLRPHLSAITAPILVIHGSADPLFPV
TSGQDIFDNIETAKLEVIEGMGHDTPSALNPQIAEMIIENMQDN
9entr-d1nyt4: Providencia rustigianii DSM 4541 Carboxyl esteraseProvidencia rustigianii DSM 4541 Show
MTNTAPLPLYYDSFGKPENPAVVLIPGLGGHNISWTTEFCQQIADAGFYI
LRPDNRDAGLSPHLSDYPSIDIAELSKKLQAGEPIDVPYTLFDMADDYIA
LLDNLSIEKAHIVGRSMGGFIAQIIAAKANHRVLSLCPIMSSTGNPNLPP
SEPDVMQMLTSSGADPKQDLDAYLAGQIAFYRRIGSTCVPFNEEHCRNYL
LQALARNYSPEGTKRQLVATVVTGDLRPHLPNVTAPTLVIHGAVDPLFPV
TSGQDIFDNIQNAELEIIDGMGHDTPPELNPIIADMIISHMQGC
9gamm-a0xyk4: Alteromonadales bacterium TW-7 probable hydrolaseAlteromonadales bacterium TW-7 Show
MRTIKTPHGITLNYQDEGNKHSPAVILIMGLGAQMTVWPDSLYYGLVNNG
FRVIRFDNRDSGLSTHLDHYPSPSLVKSWLSKRLPIQSRTPYLLDDMAND
VLALMSALKIKKAHFVGASMGGMIAQLIAAQHKKKVLSLTAIMSSSSLPR
LSAKSIGVFIKLAKLKPKTPSRDEAINYNIKLNQLIGSPAYPQTEDALRL
HATQIVERSNNPNGYKRQLIAMAASKDRQHLIRKIKTPTLVIHGSHDVVI
SVGEGKKTAMLIKKAKLKIVPGMGHNFAPELMPKMTKWLTKHIKKAQRKY
TKKKLKNHIGITKCKK
9gamm-a0ycy2: marine gamma proteobacterium HTCC2143 probable hydrolase (fragment)marine gamma proteobacterium HTCC2143 Show
DGLVDAGYHVILFDNRDTGESARLNALGEPTLWWQLLKNTVGLEVDAPYS
LNDMAADGVAVLDELGIVRAHIVGASMGGMIAQIIAAEYPNRAESLVSIM
STTGAPHLPSPESEAQSDLQGIADTSEEGEAKMHKMGIYPKAMPRQLMAI
ISAGDRSEQVRSIEVPTLVLHGEDDTLLPPPHGAHTHELIAGSKYITYAG
MGHNMPPQVVPELVVAMTRHFAGNQ
9gamm-a0z5e8: marine gamma proteobacterium HTCC2080 probable hydrolasemarine gamma proteobacterium HTCC2080 Show
MSERYVDANGICLAYDDFGNANDPAILLIMGMATQMTAWPLSFCQGLADR
GFYVVRFDNRDVGLSEKMLAAYIPSTLSMMLKAALNRPLTVSYKLGDMAN
DAIGLMDALNLDQAHVVGVSMGGMISQILAAKHPARVLSLTSIMSSSGDP
NLPRARKQVTRALLKRYLGFVKPSLESTMDFQRLIGSPGFPQDDGELEEK
VTAAFQRSFYPAGFARHMAAIMASGSRVDLLKTITAPSLVIHGSDDVLVP
VACGIDTAKQISNARLEIIEGMGHNLPESLVPILMELTAGHVSAVTSALS
PSAASGAA
9gamm-a4ada0: Congregibacter litoralis KT71 gamma proteobacterium NOR5-3 Carboxyl esterase, a/b hydrolase, 2 reference(s)Congregibacter litoralis KT71 Show
MPNVSVNTINLEYESHGNPENPTVLLIMGLGTQLTGWPPAFCDYLVDHGY
HVLRFDNRDIGLSSRLDHERTPNIPGLVILKTLKMPAPAPYTLEDMAADA
IGLLDALKIDKAHVVGASMGGMIAQLIAVHYPERTLSLTSIMSTTGHRSL
PRADRAATKALLLKPDNPDDPASIIERNVRVRKALQSRTHPKDDSEIRQT
ATEAVNRGGYYPEGVARQLAAIIVAKDRRKLLARVDAPSLVIHGEEDTLV
KVECGIDTAKHLNDSELRILPGMAHDLPTPLLQEIADGIHSVAQRA
9gamm-b5jtx2: gamma proteobacterium HTCC5015 Putative uncharacterized proteingamma proteobacterium HTCC5015 Show
MRSGHAPCNEIELYYEDLGRQGDPAVLLVCGMSVQLIEWPDSLCRHLVDQ
GFRVIRFDNREAGLSSRSTVKQAPPIIRSYYRYKRGLPVKADYPLRQLMR
DAVALLDHLDIAKAHWVGFSMGGMISQLAAIHASERVLSLTSIMSNSNDA
DLPMPRLKTLLRLITPPRNKSNEAVAHTIALLFESLQGPKYPTPRSELLE
HAHQVIQRSRRPYAGPMHQMALFAEGGWRHDLKTIQAPTLIVHGTGDPLV
RIEGGRRCAAEIPGAQLWEIEGWGHDFPAALIEDLSHGIARHLLNSQPQA
TAS
9gamm-b5jwt0: gamma proteobacterium HTCC5015 Hydrolase, alpha/beta fold familygamma proteobacterium HTCC5015 Show
MNSETSTEMMRAPHTAIQCRTGYVQANGQSLYYEDWGRESDPAIVMVMGL
AAQLIVWPTELVRSLAAQGYRVIRFDNRDIGWSSETVDCEPRHLARNWLK
YRLGRPVEAPYTLYDMVEDSIGLMDVLGIQKAHWVGASMGGMIAQLAASL
HPHRALSLTTIMSSTNERYLQWPALSVLRGLLRGRGPIHSAEQAGEALLA
FWQHIKSPALPADPQSVYRRAMAAYQRSFRPKAPLRHTLAVMATGGFAHL
LNRVRVPALVIHGSVDPLIRLDGGQDSARHLPNARLKVVDGMGHELPEAL
IDDFAAWIGDHVSATTAPNKEAPWPQGRAA
9gamm-b5jx25: gamma proteobacterium HTCC5015 Hydrolase, alpha/beta fold family proteingamma proteobacterium HTCC5015 Show
MEIQSGYAQSEANIQLYYECWGHSDHPALLMIMGLGAQMTVWPQRLLEAL
VEAGHYVVLFDNRDIGLSTATPEVQSRTMRNYIRSKLGCRVKAPYNLSDM
AGDAVAVLNHLGIEKAHVVGASMGGMIAQLLAVEHPSRVASIVGVMTSPN
ENDLPRPPLKLLMQLTGLRGEPIVDADSAARNRIQLWRMINSPEFLTDED
VVYSRAAASYTRSFRPQGAAKHSMAVMATGGFEDRLKAVKVPSLFIHGSA
DRLVHSDGGRRSARAIPGAQFELIQGMGHEIPDALCEFVAAKIAQHIATI
SE
9gamm-b8khd4: gamma proteobacterium NOR5-3 Putative uncharacterized proteingamma proteobacterium NOR5-3 Show
MKARSSAFQALLLSLVLLLITPASIARDAAFPTLNRSIVNGTDIAWTQMG
EPEGTPMLMIMGLGASHKVWGEEFCTGLVDKGFRLILLDNRDVGGSQKYD
DWGEPVLWWNMLKAKLGLEVSHAYTLSDMGDDAVALLDLLQIKRAHVLGA
SMGGMIAQTIAIEHPERVISLISIMSSTGATHLPQASKESVAAIRNVAET
SKEDLAEIHAKGFYPAAIPRQLMAIMYSGDRTAALKTLQVPTLVIHGEDD
PLLPLAHGQHTAEVIPAAQFVSFPGMAHNIPDDVRPGMLDAIEAYVRPLA
AD
9gamm-b8ksy0: gamma proteobacterium NOR51-B Putative uncharacterized proteingamma proteobacterium NOR51-B Show
MYPGAIAPPNTNSADAQTPTRFPDTTGVDFQPQAKGQPMPTAHANGIELE
YETFGDPDKPCVLLIMGLATQLTAWPDSFCQQLVKHGYFVVRFDNRDVGL
SSKLDHLKVPKIGPLILARLVGLRPPVPYTLDDMAQDAVGLLDALGIERA
HIVGASMGGMIAQLIAAKHSSRAATLTSIMSTTGHRSLPNPEPEASKAIF
MKPDDPTSRESIVIRNVRVRKAVQSPAYPKDDDELRAAAAAAVDRGGYYP
RGVSRQLAAVLHSRDRRRLLRSVRVPSLVIHGEDDPLVPVACGIDTANNL
PQSELVLYPGMGHDFPEPLMESMADHIDQLAKGV
9gamm-c8pvt7: Enhydrobacter aerosaccus SK60 Hydrolase, alpha/beta fold familyEnhydrobacter aerosaccus SK60 Show
MSDAMPTLLPDIKQQLIKEKTKEIQAQSVLDTLQSPATPNIKFRPSKHAE
FMQAAKVHTPKYKFYVEVGGDPTHPTIVLIMGLGAQSLVWPNEFCYALIN
AGFRVVRFDNRDIGKSSKLKHKKLTPAHDSPIYKAKLLGRFGLGLPLKNL
QTPYDLYDMAEDAYQLLKMLGIKKYFVIGQSMGGMIAQIMAVRYPHQVEK
LGLLSTSNNRPFSRPPAIEAIRAFTQPLPESQDTDTLTQQFVQTIKTIAS
PDYFDEQAALSKAKKLFKRRFYPKGTQRQLLAILATGSLVDIDKQIYQPT
LIIHGKQDKLIPFSHAYSLAKHIAHSQLILIDELGHDMPLALIEQLASQF
IAHFSYNAQIN
9gamm-c8pza4: Enhydrobacter aerosaccus SK60 Hydrolase, alpha/beta fold familyEnhydrobacter aerosaccus SK60 Show
MDLAKFNFEPSAITDFMQSAIIDIGDELQLCVEVGGNPDHPPLLLIMGLG
SQLVFWPDSFVKGLIDAGFFVIRFDNRDIGLSSKIARPFPRFPINNVKMM
LRMQVGLTNRHFPVAYNLFDMVEDTRRLLDKLALNNVYVVGASMGGMIAQ
ILAAKYPKRVSTLGLMFTSNNKPFLPPPKPKQLQTLLSHPKTTQIDDVVA
YGVWCMQRIGSPNHVDEEEVERLIRLRFERSYHPRGALQQLQAILATGSI
VKFDQKIKQPTIIIHGEKDGLVPSAHGRAIAKAIAHSEFHLIKDMGHDLA
KPFIPTIVKLLADHYMKHV
9gamm-q1ype7: marine gamma proteobacterium HTCC2207 probable hydrolasemarine gamma proteobacterium HTCC2207 Show
MKTIILTLLFILAAPLVSAEYSRTYIESHPLQTVAVNGIDMAYRVVGEDP
DRPKVVIIMGLGGSNVVWGDTLVKGLVEGGYELLMFDNRDVGGSTRFDDW
GQPTIWLQLIKQKLGLPVNAPYTLSDMAADTVALMDRLGYQDAHIIGTSM
GGMIAQVVAAEYPQHTRSLISIMSSTGARHLPWPTQRAEGNLRDLAEGDA
AAERDAMMRARGFYPESMPRQLMAVFKSGDRSEDVASIQASTLVMHGVDD
TLVPPPHGVHTAELIQGSEFVLLEEMGHNMPENVLPELISRMRGHMDKVE
GKQAKAARADESVKVTQAPS
9gamm-q1yty4: marine gamma proteobacterium HTCC2207 probable hydrolasemarine gamma proteobacterium HTCC2207 Show
MIEAGNTQYAQCNGLKIAYESFGKPEDPAIVLVAGLYNQLVRWPLELCQL
LVDRGFRVIRFDNRDIGLSDKFDGVRAPGYFRLLLRSYFGIPVSAPYNLD
DMAADTVGLLDALELSAAHLVGMSMGGMISQIVAGRYPDRVLSLTSIMST
SGERGKGEASLKVSLKMVQPVSKDKTPLDIAVDIWQMLCGPAYPMTDSEI
RAQVIAEHKRSSNPAGYMRQISAIRTSPSRVALLNAIKVPTLIIHGNQDV
LVPVSGGIDTAKHIAHAELVRFEGMGHTLPRELLETFADLIVNNSAVQT
9mico-a3tjp7: Janibacter sp. HTCC2649 Probable hydrolase, 1 reference(s)Janibacter sp. HTCC2649 Show
MTSAEIGDQRIEYVIDGPDDGEPILLIMGMGAQLVAWPPDFVELLVAHGF
RVIRYDNRDQGLSSFTDGPPPRRGDVAKGLAARRFAKADYTLVDLAGDAA
GLLTHLGIDSAHVVGASMGGMIAQELALNHPDRVLSLCSIMSNTGHRRFG
RTSARLLPALVRQIRAVPPTTRDEALERSVDAFRVIAGSDFDDAEMRVMA
EAHVARGAVTATSRDRQLNAINASADRTSRLHRITVPTLVIHGLKDLLVL
PSGGVATARAIPGSRLLMFPEMGHDLPRGRRVEITDAIAQNAARSSHAG
9mico-a3trw6: Janibacter sp. HTCC2649 Carboxylesterase, 1 reference(s)Janibacter sp. HTCC2649 Show
MNQLMNPETMIPVGDVELCMQTFGHTRDPAILLIHGAAASMIWWEDELCE
RLATRGRFVIRYDQRDTGRSTNDPAGHPAYDMNNLAEDAIGILDALGVER
AHIVGRSMSGGTALILAVDHPDRVETVTFMATTPGDPDLPPPTPEFMAAF
EEEAPGPDDRDAWIDYTVRVIRTFWGDSPFFDEKQVRALATLDATRTRDL
ASTNNHFAIETPGPRGGGYDDVVAPALVVHGDIDPVFPLPHALALRDSLP
SAELLVLEQTGHELPSERWDEFVAALVSHTARSAR
9noca-c0stw9: Rhodococcus sp. HI-31 Putative hydrolaseRhodococcus sp. HI-31 Show
MADRTRRVAVGELELAYETFGDAGNSPLLLISGLATQMLGWDERFCDQLA
DHGFHVIRFDNRDIGLSTHLHEGGIPNLGALLRGEAAPAPPYTLADMAED
TAGLLDALGLESAHIVGASMGGMIAQQLALHHGHRVRSLTSIMSTPSRQV
GQARPEAQAVLFLPPPTDPDTAAERSLTVYRVIGSPGYPLDEPRVAEVAR
RAFARGNNPAGVARQYAAIVVSPDRTPGLRELTVPTLVIHGEDDPLVQVE
GGLATADAVPGARLVVVPGMGHNLPQPLWPQVIDEIVAHARAAEVGPAAH
A
9rhiz-c8sk39: Mesorhizobium opportunistum WSM2075 Alpha/beta hydrolase fold proteinMesorhizobium opportunistum WSM2075 Show
MTTINRPEIISEAFGDPENPPLLLIMGAMASMLWWPEALCRKLADAGLYV
IRYDNRDTGRSTKYPPGEPPYTFDDMTDDAIGVLDSHGIDKAHVAGMSMG
GMIAQRVALRHPARVASLIVISSSPMGMDTSHLPHMSDAYAEHSAEGAGV
DWSDRGQVIDFMVRYIRATASTAHPFDEAGMRDFIERDYDRSGGFLSATN
HFLLKGSDEWNGRLREMTAPLLVIHGTTDPIFPVEHGEALAKAVAGAKLL
RVEGGGHELHPQDWPAIAAAIVAHIRSN
9rhob-a3tt13: Oceanicola batsensis HTCC2597 Probable hydrolase, 1 reference(s)Oceanicola batsensis HTCC2597 Show
MSTAQVNGIEIWYEELGPEDGKPILMISGVGTQSTRWKADFVDLLVARGY
RVIKMDNRDIGLSQKFTDHGLPDFKRVIADKAAGKTPDIPYTLSDMAADG
AALLDHLGIDKAHVCGFSMGGMIVQLMAIEHPDKVLSMSSVMSNSGNPDL
PKPTDAAMAALTRPRPDALKDRDAFINSRIETDHVIGSPAYPIPDEDLRA
QAEADLDRSYHPTGFARQYAAILATRDRRAELRNLTMPVAVIHGTDDPLV
PVTGGRDTAENCPTADLIEIPGMGHNFPHEVYEAVLDGIEKATLRA
9rhob-a3vhi4: Maritimibacter alkaliphilus HTCC2654 Putative hydrolase, 1 reference(s)Maritimibacter alkaliphilus HTCC2654 Show
MNIRIVENGPVRLATETFGDPAHPALLLIMGANASMLEWPEAFCEALATH
GRFVIRFDHRDTGQSSQFPAGDPGYTVDDMATDIIAILDAYGCADADMVG
MSLGGYIAQMVAERHPDRVRTLTLIASEPLGWDGADLPPISEAFLAHFGG
LASLDMADRAAVGAFLLEIARLCAGSAFSFARDDISARIARDLGRRDGFE
TLFNHATLEVVSDWAGAYARITLPTLVIHGTEDPILPFAKGMALAGGIPG
ARLEPLEGVGHELPGPLLEPIAALIADHVGARSRPRP
9rhob-b5kex1: Octadecabacter antarcticus 238 Putative uncharacterized proteinOctadecabacter antarcticus 238 Show
MGMHPTIESVCPIHIEIHGDKNAPCIVLVLGLGMQVAEWPLNFIRKLSEQ
FYVVCIENRDMGRSGRCGPDLEPGLARLLAEKPCGYDAGIPYTLFDMRDD
VLRAVDTLGVEKFAIVGFSMGGMIAQLVAARPDKRVTAFAQICSSGGEAS
APFPPAAYARLLAVAQVGNSNAELIDMLALDLIWFLSPSRLTEDDAKDLA
AKMLEAGFTPGGYARQLLAIQCSGDRSDDLRSIQAPTIIIGARQDRCLSL
DGSNRARELIPHAEFKVFDGIGHSLEPVALDYLTTWLCNVATAAAQKDNW
RTDHGMA
9sphi-b5apj0: Sphingobacterium sp. PM2-P1-29 Putative streptothricin resistance protein, 1 reference(s)Sphingobacterium sp. PM2-P1-29 Show
MKEKIIKTNGIELCTESFGNKKNPAILLVAGATVSMLYWDTEFCQQLSEK
GFFVIRYDNRDVGKSTNYEPGSTPYDIVDLTNDAISILDGYKIDKAHFVG
ISLGGLISQIASIKFADRVNSLTLMSSGPWGDSDPTIPEMDTSILDFHSK
AGTVNWTNEDSVVNYLIQGAELMSGKKQFDKQRSEKLIRAEFNRANNYIS
MFNHAALQGGEEYWNRLNEIKQPTLIIHGTDDKIWHYKNAGFLLEKIKGS
NLITLEGTGHELHVDDWKSIIDGIEKHIND
9sphn-a3wh04: Erythrobacter sp. NAP1 Probable hydrolaseErythrobacter sp. NAP1 Show
MPHVTANGIELCYETHGNPEHETILLVMGLGAQLAHWPIEFVEALADEGY
HVVRYDNRDIGLSQKMGDAKPPKLVWQLLRKRIGWPMDVPYTLRDMADDG
IALLDALEINRAHVVGASMGGMIAQLMAIHHSPRLLSLTSVMSTTGNPRL
PQAEKRAIEALTAPLPSLEEEAVIEHGINIARNITGPGFPADPEARRKRV
QMLVQRSVYPPGLPRQLAAIIDDGDRRSRLAQVTTPTLVLHGEDDPLVKL
EAGKDTAKHIPGAKLVTIPGWGHDLPLDLVDRMVGEITTHTRSVSEAESV
HA
9sphn-a5p8z5: Erythrobacter sp. SD-21 Probable hydrolaseErythrobacter sp. SD-21 Show
MTANGIDIHYEEHGKADDPAMLLIMGFGAQLTLWPDELVEALAMRGYRVI
RYDNRDIGLSQKFDGVKAPGLVKITLLSKIGITPQVPYGLADMAADGIGL
LDALGIEKAHIVGASMGGMIAQHVAAKYPERCLSFTQIFSTTGNPKLPPA
RKEALQALVTRPSSDEEDALVEHGIMLARTIGSPGYPTPDKRLRERTLTN
VRRSFYPEGPTRHLSAIVADGDRRAMLREITVPTLVLHGEDDPLVPCEGG
RDTASCIPEARLKTIPGWGHDLPVELVETLADEIAAHAGDATK
9sphn-q2n7c0: Erythrobacter litoralis HTCC2594 probable hydrolaseErythrobacter litoralis HTCC2594 Show
MPEVTANGITIHYDDHGPKDAEPILLIMGFGAQMTLWPMELVEALTGHGF
RVIRHDNRDVGLSQKFDGVKAPGLLKLTILGKLGFTPKVPYTLADMADDS
AGVLDALGIGQAHVVGGSMGGMIAQHVAARHPDKTKTLTSIFSTTGNPKL
PPAKKEAIQTLITRPKSLEEEVLVEHGIKLSRAIGSPGYPAEEERLRERV
REGVRRSVYPEGPTRHLSAIVADGDRREMLKSITAPTLVLHGEDDPLVPV
EGGRDTAAHIPGAKIKTIPGWGHDLPLELVEDLAAEIAAHAKAGTG
9tryp-c6k3q7: Crithidia sp. ATCC 30255 Putative hydrolase-like proteinCrithidia sp. ATCC 30255 Show
MGLASPGLFWDDRWCTSLALAGPYFVVRFDNRDVGCSTHLDEKADPKDAT
TAAPGSTSYMRFAYAVLRPGKRTIPEVYTLMDLAADAFGLLDALHVTACH
LVGSSMGGTVIQCMAIAHPERVLSLTLMSTHSSSPQTQWPSLRDMMSFIS
LMPKSTSAKYAARIAGAASSEERQRLCAERDAERVHVYAVSFTKLLERLA
GDTKKYPFDRAAAQRQMSRIFRRSLYVNGGPRQFLALLNAPSRDDDLRRC
ITSVAASNNSGAAKTTTSSAGGAAAAKSSSAVSPMYVPTIIIQGDHDPLV
PAANAKHLAAVIPGSRLYMVEGMGHTLIPSLRDTYIRLIRENIRAGEAAA
HTPARKAAQAAAARKPKATPKISSKL
9tryp-c6k3q8: Crithidia sp. ATCC 30255 Putative hydrolase-like proteinCrithidia sp. ATCC 30255 Show
MKAKNEPTMTSVPPPEQPSPNPKPVLPPQILAELRTIFPPAPQDEYASVG
CCASTKKDITICYNTFGKPSDPCMLLIMGLNSPAPYWDTRFCMYLAAAGF
YVIRYDNRDVGLSTHFDEFPTPNILRLALPSWASVGEAPLPYTLEDMAAD
AVGLLRALKITKAHVVGCSMGGMIAQLIALQYPEFVASLCLHSTSAGVAW
PKPKMLVSLLDGPESPRDVESVLDYRVRFYKAMSGDMTFYEHEFRLGMWW
DFVRSSYVAGAGRHLAAIARSSDRSALLRARLNPIESPSAASSPSSSSSS
ADCGGAALRVPVVVLHGGKDPIIPVENGRHLADCIHGSKLVIFPHMGHYF
SKDMFKLLADEMMLNARSVVVTE
9tryp-c6k3q9: Crithidia sp. ATCC 30255 Putative hydrolase-like proteinCrithidia sp. ATCC 30255 Show
MDSTSTSNSTGHAEAKPRPPAFDVHPASSTSTHVPSHSAGQTKKKPHLKH
VPHTPQMVVKVRDCPSSQMPIELCYQCFGDPKDGLPPVLLICGLNMQLYA
WDEEFCEALVRAGFFVIRYDNRDMGHSTKVERRGRVKAPLLLLPGGAATW
LGEKLPYSVEDMAADAWALLDALHIPCAHLFGISMGGMIAQTAALLAPER
TISLTSVMSSTNAPDLPQPQLWVKLWMLRKPPRNCTVEELLEFRVNSLRR
LLRSALPPDGEFLKKRFLMSLKRSSYSAGLVRQAATIRRAVGRDAALQRL
CVPALVVHGAQDVVVPPMHGYRTATMLPYARMLVLKSMGHYFHPAFYRTI
VEAFADMAASTDP
accpu-c7rr72: Accumulibacter phosphatis (strain UW-1) Alpha/beta hydrolase fold proteinAccumulibacter phosphatis Show
MPQITANQLQIEYEIFGDGPSAPAILLIMGLGAQLSRWNVELCEALVDRG
YRVIRFDNRDCGLSSKLDEAGVPDVGKSLRTGQPLLAPYTLEDMAADSVG
LLDALAIEQAHIVGASMGGAIAQIVAALYPQRVLSLTCIMTTSGHPDLPP
PTRAASQALFAPLPAARDKESLVEDAIRRQLAVASPDFPSCPQRLRDLIT
EEHERAFHPRGVTRQLAAFLASDHRREMLQTIRAPTLVLHGAEDPLIPVA
CGHDVAAHIPGAEIKVIEGMGHDLPLALTDVFADAIAAVAQRAGR
accpu-c7rtu4: Accumulibacter phosphatis (strain UW-1) Alpha/beta hydrolase fold proteinAccumulibacter phosphatis Show
MSRVGGGAPPGQQADPGQVGGEAMARANGIDICYQTLGDRGSSAILLIMG
LGMQLIAWPDAFCESLVGSGFRVIRFDNRDVGHSTHIDWRQRPRLLPSIA
RGVLGLPVRSPYRLSDMADDAIGLLDALQVARTHLVGVSMGGMIAQCMAA
RYPDRLLSLTSIMSSSGNWRVACGKPAVLRQLLRRPARPDDPSSQLDHLM
RVFGVIGSPGFPSDQADLREQLARAIRRANYAAGHYQQLLAIIAAGDRRR
ELAKIRTPTLVIHGADDPLVPVAAGYDTAKHIAGARLAIIRGMGHDLPPA
VQKLLLQAVVSHCRDAEASAASGLGPRRST
acic5-c1f7a9: Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670) Hydrolase, alpha/beta fold family, 1 reference(s)Acidobacterium capsulatum Show
MPLATIDGIHLAFDSFGNERDEALLLISGAGAQRIRWSDPFCEALAGRGF
RVIRFDNRDAGESTHLTHCATPTIADLRAAFMAGRQPEIPYSLIDMANDA
VALLDVLSIERAHIVGRSMGGAIAQVVAYEHADRVLSLTSIMSSSGNPSL
PQTPPDVMAMMASPAPDPTRDLEGFLKHGIAFARRIAGSGYVFDERAYRA
LLLEELNRGFDPGGTGRQIAALATNGDRRLQLRSIQVPTLVVHGKDDPLI
LPACGEDTAASIEGARLLLIDGMGHDIPPVFHDVLIEAITRTAHREPANY
NQKRP
acica-d0s0a7: Acinetobacter calcoaceticus, Acinetobacter sp. , Acinetobacter baumannii, Acinetobacter junii Alpha/beta hydrolase fold protein EstB, 4 reference(s)Acinetobacter calcoaceticus Show
MNSALQFNISPYTSFMQETKVNLGNGIELHVEVGGKPEHPTILLIMGLGA
QMLFWPDFFCKSLIDQGFRVIRFDNRDIGLSSKVRHEGKRLNTVKLMGRF
ALGLTNQGAPYTLHDMADDVSMLIDRLGVNKAHVIGASMGGMIAQILAAK
YPEKVEKLGLMFTSNNQPFLPPPFPKQLLSLIGKPESRDEEGIVNHSLKL
FQLIGSPGYINQIEAIQTARKLYQRSYYPAGVLQQFLAILCTGSLLQLDR
EIKQSALVLHGSRDRLLPPSHGKAVAKAISGAKFELIDGMGHDIPAHFIP
QLSGLFAHHFKSSD
acica-estB: Acinetobacter calcoaceticus DNA for EstB, 5 reference(s)Acinetobacter calcoaceticus Show
MNSALQFSSSPYTSFMHETKVKLSNGLELHVEVGGNPDHPTILLIMGLGA
QMLFWPDFFCKSLIDQGFYVIRFDNRDIGLSSKIRHKGKRLNTLKLMSRF
TLGLGNQGAPYTLYDMAEDVSLLLEAMRIKKVNVIGASMGGMIAQIIAAK
YPEKVEKLALMFTSNNQPLLPPPFPKQLFSLIGKPKSSDEDGIINHSLKL
FEIIGSPGYVNQVEAIQTARKLYQRSYHPAGVLQQFLAILCTGSLLQLDK
QISQPTLVIHGSRDRLLPPSHGKAVAKAIKGAKFELIQGMGHDIPPHFIP
QLSYLFAHHFRS
acijo-d0sar0: Acinetobacter johnsonii SH046 Alpha/beta hydrolase fold protein EstBAcinetobacter johnsonii SH046 Show
MNSALQYNLSPYTSFMRETKVDLGNGIELHVEIGGEDHHPTIVLIMGLGA
QLLFWPDFFCKSLIEQGFRIIRFDNRDIGLSSKIKHQGPRLNTLKLMGRF
ALGLDNRGAPYDLYDMADDVALLLDRLGLDESYVIGASMGGMIGQILAAR
HPQKVKKLGLMFTSNNQPLLPPPFPKQLFSLIGRPESTDEEGIVSHSLKV
FKLIGSPDYHNTIESIQTSRKLYRRSYYPAGVLQQFLAILCTGSLLQLDK
QIQQPTLVVHGSRDRLLPPSHGKAVAKAIMGAKFELIDGMGHDIPPHFIP
NLSELFAQHFKS
acilw-d0sul3: Acinetobacter lwoffii SH145 Alpha/beta hydrolase superfamily proteinAcinetobacter lwoffii SH145 Show
MYSAAQFNLSPYTSFMHETKVDLGNGIQLHVEVGGNPEHPTILLIMGLGG
QMLYWPDFFCKSLIDNDYHIIRFDNRDIGLSSKVHHKGPRLNTLKMMSRF
VLGLGNQGAPYDLYDMAEDVSLLIEKMQLEQVYVLGASMGGMIAQILAAR
YPDKVKKLGLLFTSNNQPMLPPPFPKQLFSLIDKPASTDEDGIVDHSLKL
FKIIGSPGYVNHLEAVQTARKLYKRSYYPAGVLQQFLAILCTGSLLQLDK
QIKQETLVVHGSRDRLLPPSHGKAVAKAISGAKFELIDGMGHDIPPHFIP
YLSELFADHFKS
acira-c6rme7: Acinetobacter radioresistens (strains SK82; SH164) Hydrolase, alpha/beta fold familyAcinetobacter radioresistens SK82 Show
MNSNFQLKASPYSSFMHETRVDLGNGIELHVEIGGKPEHPTILLIMGLGA
QLLYWPDFFCKSLIDQGYRVIRFDNRDIGLSSKIRHKGPRLNTFKLMGRF
ALGLQNQGAPYTLYDMADDVALLLERMGLEKTYVIGASMGGMIAQILAAR
YPDKVEKLGLMFTSNNQPLLPPPFPKQLFSLIGKPESNDEEGIISHSLKL
FEIIGSPGYINQVEAIQSARKLYQRSYYPAGVLQQFLAILCTGSLLKLDK
QIHQPTLVIHGSRDRLLPPSHGKAVAKAIPGAKFELIHGMGHDIPPHFIP
KLSSLFAHHFNHTH
agrrk-b9j7k2: Agrobacterium radiobacter (strain K84 / ATCC BAA-868) Hydrolase protein, 1 reference(s)Agrobacterium radiobacter Show
MSERIIMADGVEIATQVFGDPTDQPTLLIMGAMASMLWWPEAFCRRLAAQ
GRYVIRYDNRDTGLSTFYEPGSSPYTMDDMAEDAVHVLDAYGIDSAHLVA
MSLGGMIAQIATLAHPARVRTLTLISTTPIGIDTSALPQTSDSYMEHAAA