Family

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Family Report for: Esterase_phb_PHAZ

Esterase_phb_PHAZ


Genes:Proteins in Esterase_phb_PHAZ (8)
I.Order by Gene_locus or oder by Structures or order by number of Papers SpeciesSequence
9burk-Q5YEW3: Schlegelella sp. KB1a PHB depolymerase (phaZ) gene, 1 reference(s)Schlegelella sp. KB1a Show
MRSIRLKRLIAAVALGGAAAATQAASPLPRLNVDKTQISVSGLSAGGFMA
NQLGYAYSGTFMGVGIFAGGPYMCAGHSNYTSCMYNATITSSMRSAMQAS
IDNWSGAHIDPKAHVANQRVFLFVGNSDTTVGPNPMDAVHAQYQHNGVRR
TARVRGRNSTAHVFPTDFDATGNNACNSTASPYIANCGYDGAKAVLSRIY
GTLQPRNDAPAGANYIEFDQTAFTNNPGMASTGWVYVPANCAAGAQCRLH
VALHGCQQSTGHIGDRFVKNTGYTRWADTNNIIVLFPQAKTDNTPRNTAA
SGMLPNPNACWDWVGWYGSNFAQKTGTQAAAIKAMVDHVAS
9euro-a0a421cwa8: Aspergillus turcosus Polyhydroxybutyrate Depolymerase CBM1 domain-containing proteinAspergillus turcosus Show
MPTFATFLGLAMSGAASVSAAALGAYNVDPNSISVSGLSSGGFMSAQLGV
AYSDTFKVGFGVFAGGPYDCARSQSYTTCMYNQSPSITTPVANMKSWSGN
QINPVSNLQSRKIYMWTGSADTTVGPNVMSQLKAQLANFDTAANVSYITT
SGAVHTFPTDFDASGDNSCSSSVSPYISNCQYDGAGAVLKWMYGSLNARN
TGTLSGSIVSFSQTGEYGASGMDTTGYLYVPKACQSGSATVCKLHVALHG
CLQSYSMIGSDFVSNTGYNMWADTNNIIILYPQAVADNTMHTVWTGMSLP
NPNGCWDWVGWYGANADQLGGVQMAAIVNQVARIVSGY
acisp-Q9ZNH8: Acidovorax sp. TP4 phb depolymeraseAcidovorax sp. TP4 Show
MAFNFIRAAAAGAAIALCGVASVHAAVNLPALKIDKTQTTVSGLSSGGFM
AVQLHVAYSATFAKGVGVVAGGPFYCAEGSVVNATGRCMASPTGIPTSTL
VNTTNTWAGQGVIDPVANLQNSKVYLFSGTLDSVVKTGVMDALRTYYNSF
VPAANVVYKKDIASEHAMVTDDYGNGCSTKGAPYISDCNFDLAGAMLQHL
YGTLNARNNATLPSGNFIEFNQSEFISNHGMATTGWAYVPQACQAGGTAT
CKLHVVLHGCKQNVNDVQQQYVRNTGYNRWADSNNIVMLYPQTSLAATNS
CWDWWGYDSANYSKKSGPQMAAIKAMVDRVGSGG
calma-PHAZ: Caldimonas manganoxidans phb depolymerase precursor, 1 reference(s)Caldimonas manganoxidans Show
MKTRMLVGWAAAAVLAAGPAWAVQSLPRLNIDKSQISVSGLSSGGFMANQ
LGVAHSSTFMGVGVFAAGPYMCAGHYNYTACMYNATISDGQLSTMQSSIN
HWSGSQIDDKAGIAKQKIYLFVGTSDSTIGPNPMDALRKQYANNAVPTGN
DEYIKRSGAAHVFPTDFDAAGNNSCGSTSSPYIANCGYDGAKAVLTRIYG
TLNPRNDTPPASNYIEFSQASFTNNPGMAATGWVYVPSDCAAGAQCRLHV
ALHGCQQSYAQIGDKFIKNTGYTRWADTNRIVVLFPQTKVDNTSRSTAAS
GLLPNPNACWDWIGWYGSDFAQKGGSQISAIKAMVDHLASG
comac-PHAZCAC: Comamonas acidovorans (Pseudomonas acidovorans) polyhydroxybutyrate depolymerase, 1 reference(s)Comamonas acidovorans Show
MAFNFIRAAAAGAAMALCGVGSVHAAVNLPALKIDKTQTTVSGLSSGGFM
AVQLHVAYSATFAKGAGVVAGGPFYCAEGSIVNATGRCMASPAGIPTSTL
VSTTNTWASQGVIDPVANLQNSKVYLFSGTLDSVVKTGVMDALRTYYNSF
VPAANVVYKKDIAAEHAMVTDDYGNACSTKGAPYISDCNFDLAGAMLQHL
YGTLNARNNATLPTGNYIEFNQSEFITNHGMATTGWAYVPQACQAGGTAT
CKLHVVLHGCKQNIGDVQQQYVRNTGYNRWADTNNIVMLYPQTSTAATNS
CWDWWGYDSANYSKKSGPQMAAIKAMVDRVSSGT
comte-PHAZ: Comamonas testosteroni (Pseudomonas testosteroni), Comamonas sp, poly(3-hydroxybutyrate) depolymerase, 3 reference(s)Comamonas testosteroni Show
MRVQSWRSGVAALALWGGVNLAAGAAVPLGQYNIATDQISVSGLSSGGFM
ANQLGNAYSASFMGVGIFAAGPYMCAGLNNYTACMYNASISSAQLNAMQS
SIDSYSSAASIDAKSRIAAQKIYIFTGTSDYTVGPNLTDALQTQYLNNGV
PQGNIAYVKRSGAAHVLPTDFDSSGNNACSSSASPYISNCGYDGAKAALT
HFYGALNPRNDAPATGNYIEFNQASYTNANPGMASTGWLYVPQSCASGTQ
CRLHVVLHGCQQSTDKIGDKFVRNTGFSRWADTNNIIVLYPQTQVDNNNR
STSKSGSLANPNACWDWIGWYGNNFAQKSGVQMTAIKAMIDRIASGAG
penfu-PHAZ: Penicillium funiculosum Polyhydroxybutyrate Depolymerase, 3 reference(s), 2 structure(s).e.g. 2D80Penicillium funiculosum Show
MFDSVKIAWLVALGAAQVAATALPAFNVNPNSVSVSGLSSGGYMAAQLGV
AYSDVFNVGFGVFAGGPYDCARNQYYTSCMYNGYPSITTPTANMKSWSGN
QIASVANLGQRKIYMWTGSSDTTVGPNVMNQLKAQLGNFDNSANVSYVTT
TGAVHTFPTDFNGAGDNSCSLSTSPYISNCNYDGAGAALKWIYGSLNARN
TGTLSGSVLSFAQGSYGANGMDTTGYLYVPQSCASGATVCSLHVALHGCL
QSYSSIGSRFIQNTGYNKWADTNNMIILYPQAIPDYTSIHAIWNGGVLSN
PNGCWDWVGWYGSNADQIGGVQMAAIVGQVKQIVSGFQG
strex-PHAZ: Streptomyces exfoliatus (Streptomyces hydrogenans) poly(3-hydroxybutyrate) depolymeraseStreptomyces exfoliatus Show
MKIRQLLVAALTAVGIAATTVGGATAAVPAPTPGSLQQYNIGSTYVSGLS
SGGFMANQMHVAYSDVFEGAGIFSAGPYDCAQNSVNTAQYACMDTFMARK
TPAQLEQLTRDRATAGKVDPVANLSGDKVWLFHGTNDSTVKAAVNDDLAT
YYRDFGADVVYDNSSASGHAWVSPLGPNSCSSTTSPYVNTCGGDPVRDML
THLLGSVNPASSSALTGKLVQFNQSGYAPGGSAGAISMGNEGFAYVPQSC
QSGASCKLMVTLHGCYQYFGLVGNALMDKAYLNEYADTNDMIVLYPQATT
MTGNPRGCWDWWGYKSADYAQKSGPQMTAVMNMARALGAG
Sequences



Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer