araal-a0a087h4k1

Arabis alpina (Alpine rock-cress). Uncharacterized protein

Comment

Relationship

Family : Plant_lipase_EDS1-like

Block : L

Position in NCBI Life Tree : Arabis alpina

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAFQALTGINGDLINSAWTASKEAYGTEHYHREELETEDS
VLYAFRPSFS ENDWFAPGNDSAFAEIKMDRNQYPCMRSI
GNNVDASVNQAFLNNLELLIS PRTSFATSVKTDFNSGKQ
IVFTGHSSGGATAILATVWYLETYYRTNPNGL IPDPRCV
TFGAPLVGDRIFRHALGREKWSRFFINFVTRFDIVPRIML
ARK ASVKQTLPHVLSQLVSNKDSIEGITDFYKAVMKDTA
TVAYQAVCKLNGNG EAFLETFSSFLELSPYRPVGTFVFS
TGTSLVSVSNSDAILQILFYASQTS NDPSQSVRDHYSYE
QLVQSMGISHLDLHHLPLDEENLKMSALSGLGLSAR GEQ
CVRAALEAEKQRVQNQINMDAKWPKIKRELTWMEKTYKPM
CQTHKNG SYDSFKASNEEIDFNANVKRAELAGIYDEVLG
LVKNYQLPDEFEGRKEWI EQATRYRRLIEPLDIANYYRH
LKNEDTGPYMKEGRRPNRYKYAERGYKHD LLKPEGKNAE
TVFWSKVDGLNLGSKETMREELEISGSKSGSCFWAEVEEL
KGKPYAKVETRIKTLEGLLGGWILEKEVDDHEIFLEGST
YRKWWDSLPDY HKHQSPVRNLIIA

References

Title : Genome expansion of Arabis alpina linked with retrotransposition and reduced symmetric DNA methylation - Willing_2015_Nat.Plants_1_14023
Author(s) : Willing EM , Rawat V , Mandakova T , Maumus F , James GV , Nordstrom KJ , Becker C , Warthmann N , Chica C , Szarzynska B , Zytnicki M , Albani MC , Kiefer C , Bergonzi S , Castaings L , Mateos JL , Berns MC , Bujdoso N , Piofczyk T , de Lorenzo L , Barrero-Sicilia C , Mateos I , Piednol M , Hagmann J , Chen-Min-Tao R , Iglesias-Fernandez R , Schuster SC , Alonso-Blanco C , Roudier F , Carbonero P , Paz-Ares J , Davis SJ , Pecinka A , Quesneville H , Colot V , Lysak MA , Weigel D , Coupland G , Schneeberger K
Ref : Nat Plants , 1 :14023 , 2015
Abstract : Willing_2015_Nat.Plants_1_14023
ESTHER : Willing_2015_Nat.Plants_1_14023
PubMedSearch : Willing_2015_Nat.Plants_1_14023
PubMedID: 27246759
Gene_locus related to this paper: araal-a0a087gz21 , araal-a0a087h4k1