chick-pafa

Chick plasma PAF acetylhydrolase

Comment

Relationship

Family : PAF-Acetylhydrolase

Block : X

Position in NCBI Life Tree : Gallus gallus

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MASLWVRARRVFMKSRASGFSAKAATEMGSGGAEKGYRIP
AGKGPHAVGC TDLMTGDAAEGSFLRLYYLSCDDTDTEET
PWIPDKEYYQGLSDFLNVYRA LGERLFQYYVGSVTCPAK
SNAAFKPGEKYPLLVFSHGLGAFRTIYSAICI EMASQGF
LVAAVEHRDESASATYFCKKKADSEPEEDQTSGVEKEWIY
YRK LRAGEEERCLRHKQVQQRAQECIKALNLILKISSGE
EVMNVLNSDFDWNH LKDSVDTSRIAVMGHSFGGATVIES
LSKEIRFRCGIALDAWMLPVGDDTY QSSVQQPLLFINSE
KFQWAANILKMKKLSSNDTNKKMITIKGSVHQSFPD FTF
VSGEIIGKFFKLKGEIDPNEAIDICNHASLAFLQKHLSLK
RDFDKWD SLVDGIGPNVISGTNIDLSPTE

References

Title : Anti-inflammatory properties of a platelet-activating factor acetylhydrolase - Tjoelker_1995_Nature_374_549
Author(s) : Tjoelker LW , Wilder C , Eberhardt C , Stafforini DM
Ref : Nature , 374 :549 , 1995
Abstract : Tjoelker_1995_Nature_374_549
ESTHER : Tjoelker_1995_Nature_374_549
PubMedSearch : Tjoelker_1995_Nature_374_549
PubMedID: 7700381
Gene_locus related to this paper: bovin-pafa , canfa-pafa , chick-pafa , human-PLA2G7 , mouse-pafa

Title : Plasma platelet-activating factor acetylhydrolase is a secreted phospholipase A2 with a catalytic triad -
Author(s) : Tjoelker LW , Eberhardt C , Unger J , Le Trong H , Zimmerman GA
Ref : Journal of Biological Chemistry , 270 :25481 , 1995
PubMedID: 7592717
Gene_locus related to this paper: bovin-pafa , canfa-pafa , chick-pafa , mouse-pafa