cicar-a0a1s2xzs0

Cicer arietinum (Chickpea) (Garbanzo). uncharacterized protein LOC101511016

Comment

Relationship

Family : UCP031088

Block : X

Position in NCBI Life Tree : Cicer arietinum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MGLGIIHYDPIYSIYKVSSTFRSLPRATAPFRLRAFSTTV
HDKPSICTAD ELHYVTVSNSDWKLALWRYFPSPQAPPRN
HPLLLLSGVGTNAVGYDLSPR SSFARHMSGQGFETWILE
VRGAGLSLQGSNAEDIEQSAHAISDKMEDVLE SATNGSV
SSKKELDNISGAVSEPYNSASEGVETENAAVIGDLARLAT
AWD ESKLVATLTETFTHLSERVSGFLSESQSKVMSAKLL
DQISKLLVDSPLYE QFNEVRGKLATLLETRQSSGITSQI
TDLSEKLVDIIEAGQLSVSPPLFDL QARFTATIEDFQKQ
LDLMVKYNWDFDHYLEEDVPAAIEYIMKQSKPKDGK LLA
IGHSMGGILLYSMLSRFGSEGKESRLAAVVTLASSLDYTS
SKSTLKL LVPLADPAQALSVPVVPLGAMLAAAYEVSSRS
PYALTWLNTLISAEGMMD PDLYKRLVLNNFCTIPAKLLL
QLTTAFRERGLCNRNGTFFYKEHLHKSNI PILAVAGDKD
LICPPEAVEETVKLIPEHLVTYKLFGDPEGPHYAHYDLVG
GRLAVDQVYPCIIEFLSCHDK

References

Title : An advanced draft genome assembly of a desi type chickpea (Cicer arietinum L.) - Parween_2015_Sci.Rep_5_12806
Author(s) : Parween S , Nawaz K , Roy R , Pole AK , Venkata Suresh B , Misra G , Jain M , Yadav G , Parida SK , Tyagi AK , Bhatia S , Chattopadhyay D
Ref : Sci Rep , 5 :12806 , 2015
Abstract : Parween_2015_Sci.Rep_5_12806
ESTHER : Parween_2015_Sci.Rep_5_12806
PubMedSearch : Parween_2015_Sci.Rep_5_12806
PubMedID: 26259924
Gene_locus related to this paper: cicar-a0a1s2xzs0 , cicar-a0a1s2z0j5 , cicar-a0a1s2y5k0 , cicar-a0a3q7ye44 , cicar-a0a1s3e4q5 , cicar-a0a1s2z2b7 , cicar-a0a1s2xzw3 , cicar-a0a1s2y0c1 , cicar-a0a1s2yix9 , cicar-a0a1s2xv47 , cicar-a0a1s2ykn9 , cicar-a0a1s2yak2