cicar-a0a1s2xv47

Cicer arietinum (Chickpea) (Garbanzo). probable glutamyl endopeptidase, chloroplastic isoform X1

Comment

Relationship

Family : Glutamyl_Peptidase_S9

Block : X

Position in NCBI Life Tree : Cicer arietinum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MRLHKLYHRLTLFTLSSPLSLPSNPSLLPLAPPLILTLRR
RTSPNFTSMS TSRFHHLAPLAAVPAENSAGGTSNGSVSS
YSTADSSTDYEDDSALGVGYR VPPPEIRDIVDAPPVPAL
SFSPHRDKIIFLKRRSLPPLTELARPEEKLAG LRIDGYC
NSRSRMSFYTGLGIHQILPDGTLGPEVEIHGFPEGAKINF
VTW SPDARHLSFSIRVNEEDNNSSKLRVWVADVETGKAR
PLFQSPDVHLNAVF DNYVWVDNSTLLVCTIPLSRGAPPK
KPLVPGGPKIQSNEQKNIVQVRTFQ DLLKDEYDEDLFDY
YATSQLVLASLDGTIKDFGPPAVYTSMDPSPDEKYI MIS
SMHRPYSYIVPCGRFPKKVELWSADGKFIRELCDLPLAED
IPITSSS VRKGMRSINWRADKPSTLYWVETQDGGDAKVE
ISPRDIIYSQPAEPLEGE QPVILHKLDLRYGGISWCDDS
LAFVYESWYKTRRIKTWVVSPGSEDVTPR ILFDRSSEDV
YSDPGSPMMRRTKAGTYIIAKIKKGSDEGRYIILNGSGAT
PEGNIPFLDLFNINTGNKERIWESDKEKYFETVVALMSD
QEEGDLQLDRL KILTSKESKTENTQYYFVSWPDKKIVQL
TNFPHPYPQLASLQKEMIRYQR KDGVQLTATLYLPPGYN
PSTDGPLPCLVWSYPGEFKSKDAASQVRGSPNE FAGIGS
TSALLWLARRFAILSGPTIPIIGEGEVEANDSYVEQLVAS
AEAA VEEVIRRGVAHPKKIAVGGHSYGAFMTANLLAHAP
HLFCCGIARSGAYNR TLTPFGFQNEDRTLWEATNTYVEM
SPFMSANKIKKPILLIHGEEDNNPGT LTMQSDRFFNALK
GHGALSRLVILPYESHGYSARESIMHVLWETGRWLHK YC
VSNTSDAGEDNDTGTVKENISKGTTDAESKVVAASGGGSK
EVSDLEHE ESHSLPRSSL

References

Title : An advanced draft genome assembly of a desi type chickpea (Cicer arietinum L.) - Parween_2015_Sci.Rep_5_12806
Author(s) : Parween S , Nawaz K , Roy R , Pole AK , Venkata Suresh B , Misra G , Jain M , Yadav G , Parida SK , Tyagi AK , Bhatia S , Chattopadhyay D
Ref : Sci Rep , 5 :12806 , 2015
Abstract : Parween_2015_Sci.Rep_5_12806
ESTHER : Parween_2015_Sci.Rep_5_12806
PubMedSearch : Parween_2015_Sci.Rep_5_12806
PubMedID: 26259924
Gene_locus related to this paper: cicar-a0a1s2xzs0 , cicar-a0a1s2z0j5 , cicar-a0a1s2y5k0 , cicar-a0a3q7ye44 , cicar-a0a1s3e4q5 , cicar-a0a1s2z2b7 , cicar-a0a1s2xzw3 , cicar-a0a1s2y0c1 , cicar-a0a1s2yix9 , cicar-a0a1s2xv47 , cicar-a0a1s2ykn9 , cicar-a0a1s2yak2