cicar-a0a1s2ykn9

Cicer arietinum (Chickpea) (Garbanzo). protein EDS1L-like

Comment

Relationship

Family : Plant_lipase_EDS1-like

Block : L

Position in NCBI Life Tree : Cicer arietinum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MAGGLLGDNIGLNEEVIKKTCSLSFKAQNTSKELYISEKF
SSTSSELVYL LISFPSSWVETDWFVRKPFGETKIDLARF
PSLKSVGNDEPALVNEAFLNR FHRLLKFTSIISEVNKAI
AEGKQVVFTGHSSGGVMAILTTFCALEQNFNP KKKQIQH
KSPLCVTFGSPLIGNHIFSHASRRENWSHNFIHFVMRYDI
VPR IFLAPFSSIEKLFSHVLQLLCHNKSKPYDNVACEFY
SIVMRNVGIVTSHA ACNLMGSTNLLLENVTNFVELSPYR
PFGTYIFCNGNGQLIVVKNSDAVLQ LLFNVTQLTDSAQL
SEVANKSILQHLAYEDEIEESLGMQNVVYLDKLDDL PLS
ADDSLNADVAAALDGLGLSIRARLCLRAAGELEKQKERNE
EKIKKEV QEKGVASMRELEDYKALCEINNGKGYYDAFKV
QQDEKDFQANVKRLVLAG IWDEIIEMLKKYELPDEFEGK
EDWIILGTRFRRLVEPLDIANYYRHLKHE DTGPYMNKAR
PKRYRYTQRWLEHAKRLAKKDITESSIWAEVEELCSWISN
KKPFEDVKERVLKCEQDIKKWTEKGEELTKDVFSKDPTF
MKLWENLPVEH KSTSCISTLFTVNKG

References

Title : An advanced draft genome assembly of a desi type chickpea (Cicer arietinum L.) - Parween_2015_Sci.Rep_5_12806
Author(s) : Parween S , Nawaz K , Roy R , Pole AK , Venkata Suresh B , Misra G , Jain M , Yadav G , Parida SK , Tyagi AK , Bhatia S , Chattopadhyay D
Ref : Sci Rep , 5 :12806 , 2015
Abstract : Parween_2015_Sci.Rep_5_12806
ESTHER : Parween_2015_Sci.Rep_5_12806
PubMedSearch : Parween_2015_Sci.Rep_5_12806
PubMedID: 26259924
Gene_locus related to this paper: cicar-a0a1s2xzs0 , cicar-a0a1s2z0j5 , cicar-a0a1s2y5k0 , cicar-a0a3q7ye44 , cicar-a0a1s3e4q5 , cicar-a0a1s2z2b7 , cicar-a0a1s2xzw3 , cicar-a0a1s2y0c1 , cicar-a0a1s2yix9 , cicar-a0a1s2xv47 , cicar-a0a1s2ykn9 , cicar-a0a1s2yak2