cicar-a0a1s3e4q5

Cicer arietinum (Chickpea) (Garbanzo). tuliposide A-converting enzyme 1, chloroplastic-like

Comment

Relationship

Family : Plant_carboxylesterase

Block : H

Position in NCBI Life Tree : Cicer arietinum

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSLIAEAPEFLQVFSDGTVKRFNPETSPPTSQSSTNQYKY
KSKDIIIDPS KPITARLFIPNNSSQTTKQFPLLVYFHGG
GFCIGSTTWLGYNNFLADFAV TSQSIVLSIDYRLAPEHR
LPIAYEDCYSSLEWIAENVKIEPFLHNADLSN VFLSGDS
AGGNISHYVAVKAVKNNGFCPVKVKGLMLIHPYFGSEKRT
EKE MEEESVEDVRMNDMFWRLSLPEDSDRDFFGCNFEKD
EVFESVWLKFPAVE VYVAGKDFLKERGVMYGEFLKKKGV
NEVKVVEAEEEKHVFHVFEPDSDAT RLLQRQMSEFMKRF
G

References

Title : An advanced draft genome assembly of a desi type chickpea (Cicer arietinum L.) - Parween_2015_Sci.Rep_5_12806
Author(s) : Parween S , Nawaz K , Roy R , Pole AK , Venkata Suresh B , Misra G , Jain M , Yadav G , Parida SK , Tyagi AK , Bhatia S , Chattopadhyay D
Ref : Sci Rep , 5 :12806 , 2015
Abstract : Parween_2015_Sci.Rep_5_12806
ESTHER : Parween_2015_Sci.Rep_5_12806
PubMedSearch : Parween_2015_Sci.Rep_5_12806
PubMedID: 26259924
Gene_locus related to this paper: cicar-a0a1s2xzs0 , cicar-a0a1s2z0j5 , cicar-a0a1s2y5k0 , cicar-a0a3q7ye44 , cicar-a0a1s3e4q5 , cicar-a0a1s2z2b7 , cicar-a0a1s2xzw3 , cicar-a0a1s2y0c1 , cicar-a0a1s2yix9 , cicar-a0a1s2xv47 , cicar-a0a1s2ykn9 , cicar-a0a1s2yak2