frave-FanCXE2

Fragaria vesca subsp. probable carboxylesterase 7 FanCXE2

Comment

Relationship

Family : Plant_carboxylesterase

Block : H

Position in NCBI Life Tree : Fragaria vesca subsp. vesca

Molecular evidence

No mutation

No structure

No kinetic

No disease

No inhibitor

Database

No Interpro

No Pfam

No UniProt

No PIRSF

No SUPERFAM

Sequence

Peptide

MDPATQNDEIAFEFPPLFRLYKDGRADRLKGNETVPPSTD
PTTGVQSKDI VLSPESGLSARIYLPKLPDPTRKLPFLLY
IHGGGFVIESPSSPVYHSHVS SLAAQANVVALSIHYRRA
PEHPLPAAFEDSWAAFQWAATHSTGGGPESWL NEHADFN
RVFVAGDSAGSTLAHHVVRQSGVEGVSGVNTVGVVLFHPY
FRN EVPDKLLEVIYPTGGGLEDPKMYPGNDPRLGSLGAG
RVLVFVAEKDFLKD RGWSYYEALKKSGWSGVVEIEETEG
EDHVFHLFDPSCEKAVSLVKKVAAF MNQE

References

Title : The Functional Characterization of Carboxylesterases Involved in the Degradation of Volatile Esters Produced in Strawberry Fruits - Zhang_2022_Int.J.Mol.Sci_24_383
Author(s) : Zhang L , Zhou K , Wang M , Li R , Dai X , Liu Y , Jiang X , Xia T , Gao L
Ref : Int J Mol Sci , 24 :383 , 2022
Abstract : Zhang_2022_Int.J.Mol.Sci_24_383
ESTHER : Zhang_2022_Int.J.Mol.Sci_24_383
PubMedSearch : Zhang_2022_Int.J.Mol.Sci_24_383
PubMedID: 36613824
Gene_locus related to this paper: frave-FanCXE17 , frave-FanCXE19 , frave-FanCXE3 , frave-FanCXE2 , fraan-FaTA