lupal-a0a6a5lz53

Lupinus albus (White lupine) (Lupinus termis). Putative carboxylesterase

Comment

Relationship

Family : Plant_lipase_EDS1-like

Block : L

Position in NCBI Life Tree : Lupinus albus

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MSAVLFVDNLGLKEELIKKACSLAFKAHKSPEKSYLSEKI
KISSEPILFI SFPGLWDHTKWFSKKPFGVTKIDLNLFPS
LRSVGNDEAALVNEAFLLRFQ NILDNSSLKFEVNKAMEE
GKQIVFTGHSCGAAVAILATLWALEVYLNPNK NHKPPLC
VTFGSPLIGNHIFSHATKRENWSNHFIHFVMRFDIVPRIF
LAP YSSIEQLFSSILQYFNPKFKPSTQDSTRRGTSTCDF
YSTVMRNTATVASH AACNLMGSSNLLLETVTNFVDLSPY
RPFGTYIFCNGHGQMIVVKNSDAVL QLLFHTAQLRDLAE
LSEVANKSILEHLVYEVEMKDSFEMLNVVYLNQLEE LPL
SSDGSNSDIGTIGTALNGLGLSTRARLCLRAAGMLEKQKK
KNEEKID KEKALGSMKELEEYKATCEIQKGYYDAFKVQK
ETRDFQANVKRLVLAGIW DEIIEMLKRYELPDEFEGNSE
WVNLGTSFRRLVEPLDIANYYRHLKNEDT GPYMVKARPK
RYRYTQRWVEHANRIPIGASSESTFLAEVEELWSWSNNKK
PFEDIKEKVVKLEHDIKKWVEKGEITRDVFLKDSTFVKW
WETLPEQHKAI SCIATFIGNQ

References

Title : The genome evolution and low-phosphorus adaptation in white lupin - Xu_2020_Nat.Commun_11_1069
Author(s) : Xu W , Zhang Q , Yuan W , Xu F , Muhammad Aslam M , Miao R , Li Y , Wang Q , Li X , Zhang X , Zhang K , Xia T , Cheng F
Ref : Nat Commun , 11 :1069 , 2020
Abstract : Xu_2020_Nat.Commun_11_1069
ESTHER : Xu_2020_Nat.Commun_11_1069
PubMedSearch : Xu_2020_Nat.Commun_11_1069
PubMedID: 32103018
Gene_locus related to this paper: lupal-a0a6a5lz53 , lupal-a0a6a5mjk3

Title : High-quality genome sequence of white lupin provides insight into soil exploration and seed quality - Hufnagel_2020_Nat.Commun_11_492
Author(s) : Hufnagel B , Marques A , Soriano A , Marques L , Divol F , Doumas P , Sallet E , Mancinotti D , Carrere S , Marande W , Arribat S , Keller J , Huneau C , Blein T , Aime D , Laguerre M , Taylor J , Schubert V , Nelson M , Geu-Flores F , Crespi M , Gallardo K , Delaux PM , Salse J , Berges H , Guyot R , Gouzy J , Peret B
Ref : Nat Commun , 11 :492 , 2020
Abstract : Hufnagel_2020_Nat.Commun_11_492
ESTHER : Hufnagel_2020_Nat.Commun_11_492
PubMedSearch : Hufnagel_2020_Nat.Commun_11_492
PubMedID: 31980615
Gene_locus related to this paper: lupal-a0a6a5lz53 , lupal-a0a6a5mjk3