mizye-a0a210ptq0

Mizuhopecten yessoensis (Japanese scallop) (Patinopecten yessoensis). Carboxylic ester hydrolase PYE-110997.11

Comment

Relationship

Family : Carb_B_Mollusca

Block : C

Position in NCBI Life Tree : Mizuhopecten yessoensis

Molecular evidence

No mutation

No structure

No kinetic

No disease

No substrate

No inhibitor

Database

Sequence

Peptide

MGMTIAIWLLMMSFIASDVDCQIFNSVNTSLGPVRGLKTS
VLTGNIYQFR AIPYGKAPMGELRLRKPEPFGKWSGTYDA
TKFGPSCVQDMNTFRVGDNFL PNYNISEDCLQLNIFVPT
SASPTNRKSVIVWLYGGAFVSGQSGLYDGSYL TFIGDVI
VVTLNYRVGILGFYSTGDDAAPGNYGLWDQLLAIRWIKDN
IEA FGGNSNSITLFGESAGAMSASIHALNPNNKGLFHRA
IFESGTANQEAAFN LEIPAYAQEYGILLNCTNDNNKHPN
TTEMVDCIRTRSVQEILKSQQEHVV KKYGEFILDFSIFP
VVDGDLIPIHPMIIIKNASSPAYQFLQSLDVIGGTN SGE
GSLLIDYHGKSMERLWGLNLTEGISTDDFCSKIATEIAKD
FYHNRLH VAKEICLMYTSDVSDQDQALNVTKMYGDMVMQ
APTVSYLDRHAKDNTQSN TFQYLLSHENCIKYHRDPSWF
KGFPHASDLPYLFRPNYIGTLINADCPED TKLSDRFIKY
WSNFAKTGDPNGAGLPDWPMYNLTSYRYLNLNNNATDEGR
LYWDRVQFWNIHLQYARMDKINSSDTQINGSYSQIHYSS
IVYIVTALLVV FLVPRGVL

References

Title : Identification, characterization and expression analyses of cholinesterases genes in Yesso scallop (Patinopecten yessoensis) reveal molecular function allocation in responses to ocean acidification - Xing_2020_Aquat.Toxicol_231_105736
Author(s) : Xing Q , Liao H , Peng C , Zheng G , Yang Z , Wang J , Lu W , Huang X , Bao Z
Ref : Aquat Toxicol , 231 :105736 , 2020
Abstract : Xing_2020_Aquat.Toxicol_231_105736
ESTHER : Xing_2020_Aquat.Toxicol_231_105736
PubMedSearch : Xing_2020_Aquat.Toxicol_231_105736
PubMedID: 33422860
Gene_locus related to this paper: mizye-a0a210qls6 , mizye-a0a210qis3 , mizye-a0a210qg00 , mizye-a0a210r5n9 , mizye-a0a210qbv2 , mizye-a0a210pu25 , mizye-a0a210ptr6 , mizye-a0a210ptv1 , mizye-a0a210ptq0 , mizye-P021348901.2

Title : Scallop genome provides insights into evolution of bilaterian karyotype and development - Wang_2017_Nat.Ecol.Evol_1_120
Author(s) : Wang S , Zhang J , Jiao W , Li J , Xun X , Sun Y , Guo X , Huan P , Dong B , Zhang L , Hu X , Sun X , Wang J , Zhao C , Wang Y , Wang D , Huang X , Wang R , Lv J , Li Y , Zhang Z , Liu B , Lu W , Hui Y , Liang J , Zhou Z , Hou R , Li X , Liu Y , Li H , Ning X , Lin Y , Zhao L , Xing Q , Dou J , Mao J , Guo H , Dou H , Li T , Mu C , Jiang W , Fu Q , Fu X , Miao Y , Liu J , Yu Q , Li R , Liao H , Kong Y , Jiang Z , Chourrout D , Bao Z
Ref : Nat Ecol Evol , 1 :120 , 2017
Abstract : Wang_2017_Nat.Ecol.Evol_1_120
ESTHER : Wang_2017_Nat.Ecol.Evol_1_120
PubMedSearch : Wang_2017_Nat.Ecol.Evol_1_120
PubMedID: 28812685
Gene_locus related to this paper: mizye-a0a210qls6 , mizye-a0a210qis3 , mizye-a0a210qg00 , mizye-a0a210ped6 , mizye-a0a210q4h5 , mizye-a0a210q4h9 , mizye-a0a210q4j1 , mizye-a0a210qf86 , mizye-a0a210q332 , mizye-a0a210pqn0 , mizye-a0a210q7t5 , mizye-a0a210pij5 , mizye-a0a210qyk8 , mizye-a0a210pwl7 , mizye-a0a210q8u5 , mizye-a0a210r5n9 , mizye-a0a210qbv2 , mizye-a0a210pu25 , mizye-a0a210pek1 , mizye-a0a210pul3 , mizye-a0a210pum3 , mizye-a0a210ptr6 , mizye-a0a210ptq5 , mizye-a0a210ptc4.1 , mizye-a0a210ptc4.2 , mizye-a0a210ptv1 , mizye-a0a210ptv7 , mizye-a0a210qgl6 , mizye-a0a210qg90 , mizye-a0a210ptq0 , mizye-a0a210qg72 , mizye-a0a210ptb1 , mizye-a0a210pjd3 , mizye-a0a210qg92 , mizye-a0a210q8v2 , mizye-a0a210qg93 , mizye-a0a210q160.1 , mizye-a0a210q160.2 , mizye-a0a210qes4 , mizye-a0a210pk25 , mizye-a0a210q1b8 , mizye-a0a210q110 , mizye-a0a210r503 , mizye-P021348901.1 , mizye-P021348901.2